Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10908
Secondary Accession Numbers
  • 17209
Name Zinc finger and BTB domain-containing protein 17
Synonyms
  1. Miz-1
  2. Myc-interacting zinc finger protein 1
  3. Zinc finger protein 151
  4. Zinc finger protein 60
Gene Name ZBTB17
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function May function as a housekeeping DNA-binding protein that regulates the expression of specific genes. Has been shown to bind to the promoters of adenovirus major late protein and cyclin D1 and activate transcription. Also has potent growth arrest activity, probably through inhibition of cell cycle progression. Required for early embryonic development during gastrulation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
protein binding
nucleic acid binding
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 1p36.13
SNPs ZBTB17
Gene Sequence
>2412 bp
ATGGACTTTCCCCAGCACAGCCAGCATGTCTTGGAACAGCTGAACCAGCAGCGGCAGCTG
GGGCTTCTCTGTGACTGCACCTTTGTGGTGGACGGTGTTCACTTTAAGGCTCATAAAGCA
GTGCTGGCGGCCTGCAGCGAGTACTTCAAGATGCTCTTCGTGGACCAGAAGGACGTGGTG
CACCTGGACATCAGTAACGCGGCAGGCCTGGGGCAGGTGCTGGAGTTTATGTACACGGCC
AAGCTGAGCCTGAGCCCTGAGAACGTGGATGATGTGCTGGCCGTGGCCACTTTCCTCCAA
ATGCAGGACATCATCACGGCCTGCCATGCCCTCAAGTCACTTGCTGAGCCGGCTACCAGC
CCTGGGGGAAATGCGGAGGCCTTGGCCACAGAAGGAGGGGACAAGAGAGCCAAAGAGGAG
AAGGTGGCCACCAGCACGCTGAGCAGGCTGGAGCAGGCAGGACGCAGCACACCCATAGGC
CCCAGCAGGGACCTCAAGGAGGAGCGCGGCGGTCAGGCCCAGAGTGCGGCCAGCGGTGCA
GAGCAGACAGAGAAAGCCGATGCGCCCCGGGAGCCGCCGCCTGTGGAGCTCAAGCCAGAC
CCCACGAGTGGCATGGCTGCTGCAGAAGCTGAGGCCGCTTTGTCCGAGAGCTCGGAGCAA
GAAATGGAGGTGGAGCCCGCCCGGAAAGGGGAAGAGGAGCAAAAGGAGCAAGAGGAGCAA
GAGGAGGAGGGCGCAGGGCCAGCTGAGGTCAAGGAGGAGGGTTCCCAGCTGGAGAACGGA
GAGGCCCCCGAGGAGAACGAGAATGAGGAGTCAGCGGGCACAGACTCGGGGCAGGAGCTC
GGCTCCGAGGCCCGGGGCCTGCGCTCAGGCACCTACGGCGACCGCACGGAGTCCAAGGCC
TACGGCTCCGTCATCCACAAGTGCGAGGACTGTGGGAAGGAGTTCACGCACACGGGGAAC
TTCAAGCGGCACATCCGCATCCACACGGGGGAGAAGCCCTTCTCGTGCCGGGAGTGCAGC
AAGGCCTTTTCCGACCCGGCCGCGTGCAAGGCCCATGAGAAGACGCACAGCCCTCTGAAG
CCCTACGGCTGCGAGGAGTGCGGGAAGAGCTACCGCCTCATCAGCCTGCTGAACCTGCAC
AAGAAGCGGCACTCGGGCGAGGCGCGCTACCGCTGCGAGGACTGCGGCAAGCTCTTCACC
ACCTCGGGCAACCTCAAGCGCCACCAGCTGGTGCACAGCGGCGAGAAGCCCTACCAGTGC
GACTACTGCGGCCGCTCCTTCTCCGACCCCACTTCCAAGATGCGCCACCTGGAGACCCAC
GACACGGACAAGGAGCACAAGTGCCCACACTGCGACAAGAAGTTCAACCAGGTAGGGAAC
CTGAAGGCCCACCTGAAGATCCACATCGCTGACGGGCCCCTCAAGTGCCGAGAGTGTGGG
AAGCAGTTCACCACCTCAGGGAACCTGAAGCGGCACCTTCGGATCCACAGCGGGGAGAAG
CCCTACGTGTGCATCCACTGCCAGCGACAGTTTGCAGACCCCGGCGCTCTGCAGCGGCAC
GTCCGCATTCACACAGGTGAGAAGCCATGCCAGTGTGTGATGTGCGGTAAGGCCTTCACC
CAGGCCAGCTCCCTCATCGCCCACGTGCGCCAGCACACCGGGGAGAAGCCCTACGTCTGC
GAGCGCTGCGGCAAGAGATTCGTCCAGTCCAGCCAGTTGGCCAATCATATTCGCCACCAC
GACAACATCCGCCCACACAAGTGCAGCGTGTGCAGCAAGGCCTTCGTGAACGTGGGGGAC
CTGTCCAAGCACATCATCATTCACACTGGAGAGAAGCCTTACCTGTGTGATAAGTGTGGG
CGTGGCTTCAACCGGGTAGACAACCTGCGCTCCCACGTGAAGACCGTGCACCAGGGCAAG
GCAGGCATCAAGATCCTGGAGCCCGAGGAGGGCAGTGAGGTCAGCGTGGTCACTGTGGAT
GACATGGTCACGCTGGCTACCGAGGCACTGGCAGCGACAGCCGTCACTCAGCTCACAGTG
GTGCCGGTGGGAGCTGCAGTGACAGCCGATGAGACGGAAGTCCTGAAGGCCGAGATCAGC
AAAGCTGTGAAGCAAGTGCAGGAAGAAGACCCCAACACTCACATCCTCTACGCCTGTGAC
TCCTGTGGGGACAAGTTTCTGGATGCCAACAGCCTGGCTCAGCATGTGCGAATCCACACA
GCCCAGGCACTGGTCATGTTCCAGACAGACGCGGACTTCTATCAGCAGTATGGGCCAGGT
GGCACGTGGCCTGCCGGGCAGGTGCTGCAGGCTGGGGAGCTGGTCTTCCGCCCTCGCGAC
GGGGCTGAGGGCCAGCCCGCACTGGCAGAGACCTCCCCTACAGCTCCTGAATGTCCCCCG
CCTGCCGAGTGA
Protein Properties
Number of Residues 803
Molecular Weight 87927.0
Theoretical pI 6.42
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger and BTB domain-containing protein 17
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATS
PGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGA
EQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQKEQEEQ
EEEGAGPAEVKEEGSQLENGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKA
YGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLK
PYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQC
DYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECG
KQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFT
QASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGD
LSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVD
DMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACD
SCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRD
GAEGQPALAETSPTAPECPPPAE
GenBank ID Protein 7378713
UniProtKB/Swiss-Prot ID Q13105
UniProtKB/Swiss-Prot Entry Name ZBT17_HUMAN
PDB IDs Not Available
GenBank Gene ID AL034555
GeneCard ID ZBTB17
GenAtlas ID ZBTB17
HGNC ID HGNC:12936
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Peukert K, Staller P, Schneider A, Carmichael G, Hanel F, Eilers M: An alternative pathway for gene regulation by Myc. EMBO J. 1997 Sep 15;16(18):5672-86. [PubMed:9312026 ]
  4. Lichter P, Bray P, Ried T, Dawid IB, Ward DC: Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes. Genomics. 1992 Aug;13(4):999-1007. [PubMed:1505991 ]
  5. Tommerup N, Vissing H: Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders. Genomics. 1995 May 20;27(2):259-64. [PubMed:7557990 ]
  6. Schneider A, Peukert K, Eilers M, Hanel F: Association of Myc with the zinc-finger protein Miz-1 defines a novel pathway for gene regulation by Myc. Curr Top Microbiol Immunol. 1997;224:137-46. [PubMed:9308237 ]
  7. Piluso D, Bilan P, Capone JP: Host cell factor-1 interacts with and antagonizes transactivation by the cell cycle regulatory factor Miz-1. J Biol Chem. 2002 Nov 29;277(48):46799-808. Epub 2002 Sep 19. [PubMed:12244100 ]
  8. Wu S, Cetinkaya C, Munoz-Alonso MJ, von der Lehr N, Bahram F, Beuger V, Eilers M, Leon J, Larsson LG: Myc represses differentiation-induced p21CIP1 expression via Miz-1-dependent interaction with the p21 core promoter. Oncogene. 2003 Jan 23;22(3):351-60. [PubMed:12545156 ]
  9. Sakurai T, Itoh K, Higashitsuji H, Nagao T, Nonoguchi K, Chiba T, Fujita J: A cleaved form of MAGE-A4 binds to Miz-1 and induces apoptosis in human cells. J Biol Chem. 2004 Apr 9;279(15):15505-14. Epub 2004 Jan 22. [PubMed:14739298 ]
  10. Zhao N, Wang J, Cui Y, Guo L, Lu SH: Induction of G1 cell cycle arrest and P15INK4b expression by ECRG1 through interaction with Miz-1. J Cell Biochem. 2004 May 1;92(1):65-76. [PubMed:15095404 ]
  11. Stead MA, Trinh CH, Garnett JA, Carr SB, Baron AJ, Edwards TA, Wright SC: A beta-sheet interaction interface directs the tetramerisation of the Miz-1 POZ domain. J Mol Biol. 2007 Nov 2;373(4):820-6. Epub 2007 Aug 21. [PubMed:17880999 ]