You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10909
Secondary Accession Numbers
  • 17210
Name Zinc fingers and homeoboxes protein 1
Synonyms Not Available
Gene Name ZHX1
Protein Type Unknown
Biological Properties
General Function Involved in sequence-specific DNA binding transcription factor activity
Specific Function Acts as a transcriptional repressor
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
dna binding
sequence-specific dna binding
sequence-specific dna binding transcription factor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:8
Locus 8q24.13
SNPs ZHX1
Gene Sequence
>2622 bp
ATGGCAAGCAGGCGAAAATCAACAACACCTTGCATGGTCCTTGCCAGTGAACAAGATCCA
GACCTTGAGTTGATATCAGATTTGGATGAAGGTCCTCCTGTGCTTACACCTGTAGAAAAC
ACCAGAGCAGAGAGTATCTCAAGTGATGAAGAGGTTCATGAATCTGTGGATTCAGACAAT
CAGCAAAATAAAAAAGTTGAAGGTGGATATGAATGTAAATATTGTACTTTTCAAACTCCA
GATCTAAATATGTTTACTTTTCATGTGGATTCGGAACATCCCAATGTAGTGCTAAATTCA
TCCTATGTTTGTGTCGAATGCAATTTTCTTACCAAAAGGTATGATGCACTTTCTGAGCAT
AATCTGAAATATCACCCAGGAGAAGAGAATTTTAAGTTGACTATGGTGAAACGTAATAAC
CAGACAATCTTTGAACAAACAATAAATGATCTGACTTTTGATGGTAGTTTTGTTAAAGAG
GAGAATGCAGAGCAAGCAGAATCTACAGAAGTTTCTTCTTCGGGAATATCTATCAGTAAA
ACTCCTATCATGAAAATGATGAAAAATAAAGTGGAAAATAAACGGATTGCAGTTCATCAT
AACTCAGTTGAGGACGTTCCTGAAGAGAAAGAGAATGAAATCAAACCAGACCGTGAAGAA
ATTGTAGAAAATCCAAGTTCTTCAGCTTCTGAATCTAATACAAGTACTTCCATTGTAAAC
AGAATACATCCAAGTACTGCCAGCACGGTAGTGACACCAGCAGCAGTTCTTCCTGGATTG
GCACAGGTGATAACTGCTGTATCTGCTCAGCAGAATTCTAATTTGATTCCCAAAGTCTTA
ATCCCTGTTAATAGCATTCCCACCTACAATGCTGCATTGGATAACAATCCCCTTTTACTT
AACACCTACAACAAGTTCCCTTACCCAACAATGTCAGAAATTACAGTTCTTTCTGCTCAA
GCAAAATATACAGAGGAACAGATCAAGATATGGTTTTCAGCCCAACGTTTAAAACATGGT
GTTAGTTGGACTCCCGAGGAAGTAGAGGAGGCAAGAAGGAAACAATTCAATGGAACAGTG
CATACTGTACCTCAGACCATAACTGTTATTCCTACACACATTTCCACAGGGAGTAATGGT
TTACCATCTATTTTACAGACATGCCAAATAGTTGGTCAGCCTGGTCTGGTCCTTACTCAA
GTGGCTGGAACAAACACCTTGCCAGTTACAGCACCTATAGCCTTGACAGTGGCAGGCGTT
CCAAGTCAAAATAATATACAGAAAAGTCAGGTACCTGCTGCTCAGCCTACTGCAGAAACA
AAGCCAGCAACAGCAGCAGTTCCAACTTCTCAAAGTGTCAAACATGAAACTGCATTGGTA
AACCCTGATTCATTTGGCATTCGGGCAAAAAAGACAAAAGAGCAACTGGCAGAATTAAAA
GTTAGCTACCTTAAAAATCAGTTTCCCCATGATTCAGAAATTATCAGACTTATGAAAATA
ACAGGCCTGACGAAAGGAGAGATTAAAAAATGGTTTAGTGACACAAGGTACAACCAGAGA
AATTCAAAGAGTAATCAGTGCTTACATCTCAACAATGATTCCTCTACCACCATTATTATA
GACTCCAGTGATGAAACCACGGAATCCCCAACTGTTGGTACTGCACAGCCTAAGCAATCC
TGGAATCCTTTTCCTGACTTTACTCCCCAAAAGTTTAAAGAGAAAACTGCAGAGCAGCTT
CGTGTCCTTCAGGCAAGTTTTCTCAACAGCTCTGTACTTACAGATGAAGAATTAAATAGG
TTAAGGGCACAAACCAAACTTACCAGAAGAGAAATCGATGCTTGGTTTACAGAGAAGAAG
AAATCAAAAGCTTTAAAGGAAGAGAAAATGGAAATAGATGAAAGTAATGCAGGTAGTTCC
AAAGAAGAAGCTGGAGAAACTTCTCCTGCAGATGAATCTGGTGCACCTAAGTCAGGGAGT
ACAGGCAAGATATGTAAAAAAACACCTGAGCAGCTGCACATGCTTAAGAGTGCATTTGTC
CGGACACAGTGGCCATCACCAGAAGAGTATGACAAGTTGGCCAAAGAAAGCGGGCTTGCT
AGAACAGACATAGTTAGTTGGTTTGGGGACACCCGTTATGCTTGGAAGAATGGAAACTTG
AAATGGTACTACTACTATCAGAGCGCCAATTCAAGTAGTATGAATGGTCTGTCTTCCCTT
AGGAAAAGAGGGAGAGGGAGACCCAAAGGACGGGGAAGAGGAAGACCGCGTGGGCGGCCT
AGAGGAAGCAAAAGAATTAACAACTGGGACAGGGGACCATCACTCATAAAATTTAAAACT
GGAACTGCAATACTTAAGGATTATTACCTGAAGCACAAGTTTCTTAATGAGCAAGACCTT
GATGAACTTGTTAACAAATCACATATGGGCTATGAGCAGGTCAGAGAGTGGTTTGCAGAA
AGACAGAGAAGATCAGAATTAGGTATAGAATTATTTGAGGAAAATGAGGAGGAAGATGAA
GTTATTGATGACCAGGAAGAGGATGAAGAAGAAACAGATGATAGTGACACTTGGGAACCT
CCACGACATGTGAAACGGAAGCTGTCTAAATCAGATGACTGA
Protein Properties
Number of Residues 873
Molecular Weight 98096.8
Theoretical pI 5.91
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc fingers and homeoboxes protein 1
MASRRKSTTPCMVLASEQDPDLELISDLDEGPPVLTPVENTRAESISSDEEVHESVDSDN
QQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEH
NLKYHPGEENFKLTMVKRNNQTIFEQTINDLTFDGSFVKEENAEQAESTEVSSSGISISK
TPIMKMMKNKVENKRIAVHHNSVEDVPEEKENEIKPDREEIVENPSSSASESNTSTSIVN
RIHPSTASTVVTPAAVLPGLAQVITAVSAQQNSNLIPKVLIPVNSIPTYNAALDNNPLLL
NTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGVSWTPEEVEEARRKQFNGTV
HTVPQTITVIPTHISTGSNGLPSILQTCQIVGQPGLVLTQVAGTNTLPVTAPIALTVAGV
PSQNNIQKSQVPAAQPTAETKPATAAVPTSQSVKHETALVNPDSFGIRAKKTKEQLAELK
VSYLKNQFPHDSEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSTTIII
DSSDETTESPTVGTAQPKQSWNPFPDFTPQKFKEKTAEQLRVLQASFLNSSVLTDEELNR
LRAQTKLTRREIDAWFTEKKKSKALKEEKMEIDESNAGSSKEEAGETSPADESGAPKSGS
TGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESGLARTDIVSWFGDTRYAWKNGNL
KWYYYYQSANSSSMNGLSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWDRGPSLIKFKT
GTAILKDYYLKHKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGIELFEENEEEDE
VIDDQEEDEEETDDSDTWEPPRHVKRKLSKSDD
GenBank ID Protein 5757884
UniProtKB/Swiss-Prot ID Q9UKY1
UniProtKB/Swiss-Prot Entry Name ZHX1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF106862
GeneCard ID ZHX1
GenAtlas ID ZHX1
HGNC ID HGNC:12871
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  7. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  8. Yamada K, Printz RL, Osawa H, Granner DK: Human ZHX1: cloning, chromosomal location, and interaction with transcription factor NF-Y. Biochem Biophys Res Commun. 1999 Aug 11;261(3):614-21. [PubMed:10441475 ]
  9. Yamada K, Osawa H, Granner DK: Identification of proteins that interact with NF-YA. FEBS Lett. 1999 Oct 22;460(1):41-5. [PubMed:10571058 ]
  10. Yamada K, Kawata H, Matsuura K, Shou Z, Hirano S, Mizutani T, Yazawa T, Yoshino M, Sekiguchi T, Kajitani T, Miyamoto K: Functional analysis and the molecular dissection of zinc-fingers and homeoboxes 1 (ZHX1). Biochem Biophys Res Commun. 2002 Sep 20;297(2):368-74. [PubMed:12237128 ]
  11. Yamada K, Kawata H, Shou Z, Hirano S, Mizutani T, Yazawa T, Sekiguchi T, Yoshino M, Kajitani T, Miyamoto K: Analysis of zinc-fingers and homeoboxes (ZHX)-1-interacting proteins: molecular cloning and characterization of a member of the ZHX family, ZHX3. Biochem J. 2003 Jul 1;373(Pt 1):167-78. [PubMed:12659632 ]
  12. Kawata H, Yamada K, Shou Z, Mizutani T, Yazawa T, Yoshino M, Sekiguchi T, Kajitani T, Miyamoto K: Zinc-fingers and homeoboxes (ZHX) 2, a novel member of the ZHX family, functions as a transcriptional repressor. Biochem J. 2003 Aug 1;373(Pt 3):747-57. [PubMed:12741956 ]