You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10910
Secondary Accession Numbers
  • 17211
Name Zinc finger protein with KRAB and SCAN domains 1
Synonyms
  1. Zinc finger protein 139
  2. Zinc finger protein 36
  3. Zinc finger protein KOX18
Gene Name ZKSCAN1
Protein Type Unknown
Biological Properties
General Function Involved in nucleic acid binding
Specific Function May be involved in transcriptional regulation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
sequence-specific dna binding transcription factor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus (Potential)
Gene Properties
Chromosome Location Chromosome:7
Locus 7q22
SNPs ZKSCAN1
Gene Sequence
>1692 bp
ATGATGACTGCTGAATCACGGGAAGCCACGGGTCTGTCCCCACAGGCTGCACAGGAGAAG
GATGGTATCGTAATAGTGAAGGTGGAAGAGGAAGATGAGGAAGACCACATGTGGGGGCAG
GATTCCACCCTACAGGACACGCCTCCTCCAGACCCAGAGATATTCCGCCAACGCTTCAGG
CGCTTCTGTTACCAGAACACTTTTGGGCCCCGAGAGGCTCTCAGTCGGCTGAAGGAACTT
TGTCATCAGTGGCTGCGGCCAGAAATAAACACCAAGGAACAGATCCTGGAGCTTCTGGTG
CTAGAGCAGTTTCTTTCCATCCTGCCCAAGGAGCTCCAGGTCTGGCTGCAGGAATACCGC
CCCGATAGTGGAGAGGAGGCCGTGACCCTTCTAGAAGACTTGGAGCTTGATTTATCAGGA
CAACAGGTCCCAGGTCAAGTTCATGGACCTGAGATGCTCGCAAGGGGGATGGTGCCTCTG
GATCCAGTTCAGGAGTCCTCGAGCTTTGACCTTCATCACGAGGCCACCCAGTCCCACTTC
AAACATTCGTCTCGGAAACCCCGCCTCTTACAGTCACGAGCTCTTCCTGCTGCCCACATT
CCTGCACCCCCTCATGAGGGTAGTCCCAGAGACCAGGCGATGGCATCTGCACTATTCACA
GCGGATTCCCAGGCAATGGTGAAGATCGAGGACATGGCTGTGTCCCTCATTCTGGAGGAA
TGGGGATGTCAGAATCTGGCTCGGAGGAATCTCAGTAGGGACAACAGGCAGGAGAATTAT
GGGAGCGCATTTCCCCAGGGTGGTGAAAACAGGAATGAGAACGAGGAGTCAACCTCAAAG
GCTGAAACCTCGGAAGATTCAGCATCACGCGGGGAGACAACAGGAAGATCCCAGAAAGAG
TTTGGAGAGAAACGTGACCAGGAGGGCAAAACAGGAGAAAGACAGCAGAAAAACCCTGAG
GAGAAAACCAGGAAAGAGAAAAGAGATTCAGGGCCAGCTATAGGAAAGGACAAAAAAACC
ATCACAGGAGAGAGAGGTCCAAGGGAGAAGGGGAAAGGATTGGGAAGAAGCTTCAGTCTG
AGCTCCAACTTCACCACCCCTGAAGAAGTTCCCACGGGAACAAAGTCTCACAGATGTGAT
GAATGTGGTAAATGCTTCACGAGAAGTTCAAGCCTTATCCGCCATAAAATAATCCACACT
GGAGAAAAGCCCTATGAATGTAGTGAGTGTGGGAAAGCCTTCAGTCTTAACTCCAACCTT
GTCCTGCATCAGAGGATCCACACAGGAGAGAAACCTCATGAATGTAACGAGTGTGGCAAG
GCCTTCAGCCACAGTTCCAATCTCATCCTCCATCAGCGCATCCACTCTGGAGAGAAACCT
TATGAATGTAATGAGTGCGGGAAGGCCTTCAGCCAGAGCTCGGACCTCACCAAGCATCAG
AGAATTCACACGGGGGAGAAACCCTATGAATGTAGTGAATGTGGAAAAGCTTTCAACCGA
AACTCATACCTGATTTTGCATCGGAGAATTCACACTCGAGAAAAGCCCTACAAGTGCACT
AAGTGTGGCAAGGCCTTCACCCGCAGCTCCACCCTCACTCTGCATCACAGAATCCATGCC
AGAGAGAGAGCCTCTGAGTACAGCCCAGCCTCCCTTGATGCATTTGGCGCGTTCCTGAAA
AGTTGTGTGTAA
Protein Properties
Number of Residues 563
Molecular Weight 63629.5
Theoretical pI 7.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein with KRAB and SCAN domains 1
MMTAESREATGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSTLQDTPPPDPEIFRQRFR
RFCYQNTFGPREALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYR
PDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDPVQESSSFDLHHEATQSHF
KHSSRKPRLLQSRALPAAHIPAPPHEGSPRDQAMASALFTADSQAMVKIEDMAVSLILEE
WGCQNLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKE
FGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSL
SSNFTTPEEVPTGTKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQ
RIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHA
RERASEYSPASLDAFGAFLKSCV
GenBank ID Protein 18676580
UniProtKB/Swiss-Prot ID P17029
UniProtKB/Swiss-Prot Entry Name ZKSC1_HUMAN
PDB IDs Not Available
GenBank Gene ID AK074116
GeneCard ID ZKSCAN1
GenAtlas ID ZKSCAN1
HGNC ID HGNC:13101
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  8. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  9. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205 ]
  10. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  11. Jikuya H, Takano J, Kikuno R, Hirosawa M, Nagase T, Nomura N, Ohara O: Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones. DNA Res. 2003 Feb 28;10(1):49-57. [PubMed:12693554 ]
  12. Thiesen HJ: Multiple genes encoding zinc finger domains are expressed in human T cells. New Biol. 1990 Apr;2(4):363-74. [PubMed:2288909 ]
  13. Tommerup N, Vissing H: Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders. Genomics. 1995 May 20;27(2):259-64. [PubMed:7557990 ]