You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10922
Secondary Accession Numbers
  • 17223
Name Zinc transporter 5
Synonyms
  1. Solute carrier family 30 member 5
  2. ZnT-5
  3. ZnT-like transporter 1
  4. hZTL1
Gene Name SLC30A5
Protein Type Unknown
Biological Properties
General Function Involved in cation transmembrane transporter activity
Specific Function Functions as a zinc transporter. May be a transporter of zinc into beta cells in order to form insulin crystals. Partly regulates cellular zinc homeostasis. Required with ZNT7 for the activation of zinc-requiring enzymes, alkaline phosphatases (ALPs). Transports zinc into the lumens of the Golgi apparatus and vesicular compartments where ALPs locate, thus, converting apoALPs to holoALPs. Required with ZNT6 and ZNT7 for the activation of TNAP.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
response to zinc ion
regulation of proton transport
cellular zinc ion homeostasis
cobalt ion transport
Cellular Component
nucleolus
apical plasma membrane
secretory granule membrane
Golgi membrane
integral to plasma membrane
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
transporter activity
Molecular Function
zinc ion transmembrane transporter activity
zinc ion binding
Process
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Golgi apparatus
  2. Multi-pass membrane protein
  3. trans-Golgi network membrane
Gene Properties
Chromosome Location 5
Locus 5q12.1
SNPs SLC30A5
Gene Sequence
>2298 bp
ATGGAGGAGAAATACGGCGGGGACGTGCTGGCCGGCCCCGGCGGCGGCGGCGGCCTTGGG
CCGGTGGACGTACCCAGCGCTCGATTAACAAAATATATTGTGTTACTATGTTTCACTAAA
TTTTTGAAGGCTGTGGGACTTTTCGAATCATATGATCTCCTAAAAGCTGTTCACATTGTT
CAGTTCATTTTTATATTAAAACTTGGGACTGCATTTTTTATGGTTTTGTTTCAAAAGCCA
TTTTCTTCTGGGAAAACTATTACCAAACACCAGTGGATCAAAATATTTAAACATGCAGTT
GCTGGGTGTATTATTTCACTCTTGTGGTTTTTTGGCCTCACTCTTTGTGGACCACTAAGG
ACTTTGCTGCTATTTGAGCACAGTGATATTGTTGTCATTTCACTACTCAGTGTTTTGTTC
ACCAGTTCTGGAGGAGGACCAGCAAAGACAAGGGGAGCTGCTTTTTTCATTATTGCTGTG
ATCTGTTTATTGCTTTTTGACAATGATGATCTCATGGCTAAAATGGCTGAACACCCTGAA
GGACATCATGACAGTGCTCTAACTCATATGCTTTACACAGCCATTGCCTTCTTAGGTGTG
GCAGATCACAAGGGTGGAGTATTATTGCTAGTACTGGCTTTGTGTTGTAAAGTTGGTTTT
CATACAGCTTCCAGAAAGCTCTCTGTCGACGTTGGTGGAGCTAAACGTCTTCAAGCTTTA
TCTCATCTTGTTTCTGTGCTTCTCTTGTGCCCATGGGTCATTGTTCTTTCTGTGACAACT
GAGAGTAAAGTGGAGTCTTGGTTTTCTCTCATTATGCCTTTTGCAACGGTTATCTTTTTT
GTCATGATCCTGGATTTCTACGTGGATTCCATTTGTTCAGTCAAAATGGAAGTTTCCAAA
TGTGCTCGTTATGGATCCTTTCCCATTTTTATTAGTGCTCTCCTTTTTGGAAATTTTTGG
ACACATCCAATAACAGACCAGCTTCGGGCTATGAACAAAGCAGCACACCAGGAGAGCACT
GAACACGTCCTGTCTGGAGGAGTGGTAGTGAGTGCTATATTCTTCATTTTGTCTGCCAAT
ATCTTATCATCTCCCTCTAAGAGAGGACAAAAAGGTACCCTTATTGGATATTCTCCTGAA
GGAACACCTCTTTATAACTTCATGGGTGATGCTTTTCAGCATAGCTCTCAATCGATCCCT
AGGTTTATTAAGGAATCACTAAAACAAATTCTTGAGGAGAGTGACTCTAGGCAGATCTTT
TACTTCTTGTGCTTGAATCTGCTTTTTACCTTTGTGGAATTATTCTATGGCGTGCTGACC
AATAGTCTGGGCCTGATCTCGGATGGATTCCACATGCTTTTTGACTGCTCTGCTTTAGTC
ATGGGACTTTTTGCTGCCCTGATGAGTAGGTGGAAAGCCACTCGGATTTTCTCCTATGGG
TACGGCCGAATAGAAATTCTGTCTGGATTTATTAATGGACTTTTTCTAATAGTAATAGCG
TTTTTTGTGTTTATGGAGTCAGTGGCTAGATTGATTGATCCTCCAGAATTAGACACTCAC
ATGTTAACACCAGTCTCAGTTGGAGGGCTGATAGTAAACCTTATTGGTATCTGTGCCTTT
AGCCATGCCCATAGCCATGCCCATGGAGCTTCTCAAGGAAGCTGTCACTCATCTGATCAC
AGCCATTCACACCATATGCATGGACACAGTGACCATGGGCATGGTCACAGCCACGGATCT
GCGGGTGGAGGCATGAATGCTAACATGAGGGGTGTATTTCTACATGTTTTGGCAGATACT
CTTGGCAGCATTGGTGTGATCGTATCCACAGTTCTTATAGAGCAGTTTGGATGGTTCATC
GCTGACCCACTCTGTTCTCTTTTTATTGCTATATTAATATTTCTCAGTGTTGTTCCACTG
ATTAAAGATGCCTGCCAGGTTCTACTCCTGAGATTGCCACCAGAATATGAAAAAGAACTA
CATATTGCTTTAGAAAAGATACAGAAAATTGAAGGATTAATATCATACCGAGACCCTCAT
TTTTGGCGTCATTCTGCTAGTATTGTGGCAGGAACAATTCATATACAGGTGACATCTGAT
GTGCTAGAACAAAGAATAGTACAGCAGGTTACAGGAATACTTAAAGATGCTGGAGTAAAC
AATTTAACAATTCAAGTGGAAAAGGAGGCATACTTTCAACATATGTCTGGCCTAAGTACT
GGATTTCATGATGTTCTGGCTATGACAAAACAAATGGAATCCATGAAATACTGCAAAGAT
GGTACTTACATCATGTGA
Protein Properties
Number of Residues 765
Molecular Weight 8215.54
Theoretical pI 9.919
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Zinc transporter 5
MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIV
QFIFILKLGTAFFMVLFQKPFSSGKTITKHQWIKIFKHAVAGCIISLLWFFGLTLCGPLR
TLLLFEHSDIVVISLLSVLFTSSGGGPAKTRGAAFFIIAVICLLLFDNDDLMAKMAEHPE
GHHDSALTHMLYTAIAFLGVADHKGGVLLLVLALCCKVGFHTASRKLSVDVGGAKRLQAL
SHLVSVLLLCPWVIVLSVTTESKVESWFSLIMPFATVIFFVMILDFYVDSICSVKMEVSK
CARYGSFPIFISALLFGNFWTHPITDQLRAMNKAAHQESTEHVLSGGVVVSAIFFILSAN
ILSSPSKRGQKGTLIGYSPEGTPLYNFMGDAFQHSSQSIPRFIKESLKQILEESDSRQIF
YFLCLNLLFTFVELFYGVLTNSLGLISDGFHMLFDCSALVMGLFAALMSRWKATRIFSYG
YGRIEILSGFINGLFLIVIAFFVFMESVARLIDPPELDTHMLTPVSVGGLIVNLIGICAF
SHAHSHAHGASQGSCHSSDHSHSHHMHGHSDHGHGHSHGSAGGGMNANMRGVFLHVLADT
LGSIGVIVSTVLIEQFGWFIADPLCSLFIAILIFLSVVPLIKDACQVLLLRLPPEYEKEL
HIALEKIQKIEGLISYRDPHFWRHSASIVAGTIHIQVTSDVLEQRIVQQVTGILKDAGVN
NLTIQVEKEAYFQHMSGLSTGFHDVLAMTKQMESMKYCKDGTYIM
GenBank ID Protein 20070323
UniProtKB/Swiss-Prot ID Q8TAD4
UniProtKB/Swiss-Prot Entry Name ZNT5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_022902.2
GeneCard ID SLC30A5
GenAtlas ID SLC30A5
HGNC ID HGNC:19089
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  5. Kambe T, Narita H, Yamaguchi-Iwai Y, Hirose J, Amano T, Sugiura N, Sasaki R, Mori K, Iwanaga T, Nagao M: Cloning and characterization of a novel mammalian zinc transporter, zinc transporter 5, abundantly expressed in pancreatic beta cells. J Biol Chem. 2002 May 24;277(21):19049-55. Epub 2002 Mar 19. [PubMed:11904301 ]
  6. Cragg RA, Christie GR, Phillips SR, Russi RM, Kury S, Mathers JC, Taylor PM, Ford D: A novel zinc-regulated human zinc transporter, hZTL1, is localized to the enterocyte apical membrane. J Biol Chem. 2002 Jun 21;277(25):22789-97. Epub 2002 Apr 5. [PubMed:11937503 ]
  7. Devergnas S, Chimienti F, Naud N, Pennequin A, Coquerel Y, Chantegrel J, Favier A, Seve M: Differential regulation of zinc efflux transporters ZnT-1, ZnT-5 and ZnT-7 gene expression by zinc levels: a real-time RT-PCR study. Biochem Pharmacol. 2004 Aug 15;68(4):699-709. [PubMed:15276077 ]
  8. Suzuki T, Ishihara K, Migaki H, Ishihara K, Nagao M, Yamaguchi-Iwai Y, Kambe T: Two different zinc transport complexes of cation diffusion facilitator proteins localized in the secretory pathway operate to activate alkaline phosphatases in vertebrate cells. J Biol Chem. 2005 Sep 2;280(35):30956-62. Epub 2005 Jul 1. [PubMed:15994300 ]
  9. Suzuki T, Ishihara K, Migaki H, Matsuura W, Kohda A, Okumura K, Nagao M, Yamaguchi-Iwai Y, Kambe T: Zinc transporters, ZnT5 and ZnT7, are required for the activation of alkaline phosphatases, zinc-requiring enzymes that are glycosylphosphatidylinositol-anchored to the cytoplasmic membrane. J Biol Chem. 2005 Jan 7;280(1):637-43. Epub 2004 Nov 2. [PubMed:15525635 ]