You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10923
Secondary Accession Numbers
  • 17224
Name Zinc finger protein ZIC 3
Synonyms
  1. Zinc finger protein of the cerebellum 3
Gene Name ZIC3
Protein Type Unknown
Biological Properties
General Function Involved in zinc ion binding
Specific Function Probably functions as a transcription factor in the earliest stages of the left-right (LR) body axis formation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs ZIC3
Gene Sequence
>1404 bp
ATGACGATGCTCCTGGACGGAGGCCCGCAGTTCCCTGGGCTGGGAGTGGGCAGCTTCGGC
GCGCCGCGCCACCACGAGATGCCCAACCGTGAGCCGGCAGGCATGGGGCTGAATCCCTTC
GGGGACTCAACCCACGCCGCCGCCGCCGCCGCCGCCGCCGCTGCCTTCAAGCTGAGCCCT
GCCGCGGCGCACGATCTATCTTCAGGCCAGAGCTCGGCTTTCACGCCGCAGGGTTCGGGC
TACGCCAACGCCCTGGGCCACCATCACCACCACCATCACCATCATCACCACACCAGCCAG
GTGCCCAGCTACGGTGGCGCTGCCTCTGCCGCCTTCAACTCAACGCGCGAGTTTCTGTTC
CGCCAGCGCAGCTCCGGGCTCAGTGAGGCGGCCTCGGGTGGCGGGCAGCACGGGCTCTTC
GCCGGCTCGGCGAGCAGCCTGCATGCTCCAGCTGGCATCCCCGAGCCCCCTAGCTACTTG
CTGTTTCCCGGGCTGCATGAGCAGGGCGCTGGGCACCCGTCTCCCACAGGGCACGTGGAC
AACAACCAGGTCCACCTGGGGCTGCGTGGGGAGCTGTTCGGCCGTGCTGACCCATACCGC
CCAGTGGCCAGCCCGCGCACGGACCCATACGCGGCCGGCGCTCAGTTTCCTAACTACAGC
CCCATGAACATGAACATGGGAGTGAACGTGGCGGCCCACCACGGGCCCGGCGCCTTCTTC
CGTTATATGCGGCAGCCTATCAAGCAGGAGCTGTCGTGCAAGTGGATCGACGAGGCTCAG
CTGAGCCGGCCCAAGAAGAGCTGCGACCGGACCTTCAGCACCATGCATGAGCTGGTGACA
CATGTCACCATGGAGCATGTGGGGGGCCCGGAGCAGAACAACCACGTCTGCTACTGGGAG
GAGTGCCCCCGGGAGGGCAAGTCTTTCAAGGCGAAGTACAAACTGGTCAACCACATCCGA
GTGCACACGGGCGAGAAGCCCTTCCCATGCCCCTTCCCGGGCTGCGGGAAGATCTTTGCC
CGTTCTGAGAACCTCAAGATCCACAAGAGGACCCACACAGGTGAGAAACCTTTCAAATGT
GAATTTGAAGGCTGTGACAGACGCTTTGCCAACAGCAGCGACCGTAAGAAGCACATGCAT
GTGCATACCTCGGACAAGCCCTATATCTGCAAAGTGTGCGACAAGTCCTACACGCACCCG
AGCTCCCTGCGCAAACACATGAAGGTTCATGAATCTCAAGGGTCAGATTCCTCCCCTGCT
GCCAGTTCAGGCTATGAATCTTCCACTCCACCCGCTATAGCTTCTGCAAACAGTAAAGAT
ACCACTAAAACCCCTTCTGCAGTTCAAACTAGCACCAGCCACAACCCTGGACTTCCTCCT
AATTTTAACGAATGGTACGTCTGA
Protein Properties
Number of Residues 467
Molecular Weight 50569.1
Theoretical pI 8.81
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein ZIC 3
MTMLLDGGPQFPGLGVGSFGAPRHHEMPNREPAGMGLNPFGDSTHAAAAAAAAAAFKLSP
AAAHDLSSGQSSAFTPQGSGYANALGHHHHHHHHHHHTSQVPSYGGAASAAFNSTREFLF
RQRSSGLSEAASGGGQHGLFAGSASSLHAPAGIPEPPSYLLFPGLHEQGAGHPSPTGHVD
NNQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFF
RYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWE
ECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKC
EFEGCDRRFANSSDRKKHMHVHTSDKPYICKVCDKSYTHPSSLRKHMKVHESQGSDSSPA
ASSGYESSTPPAIASANSKDTTKTPSAVQTSTSHNPGLPPNFNEWYV
GenBank ID Protein 2957266
UniProtKB/Swiss-Prot ID O60481
UniProtKB/Swiss-Prot Entry Name ZIC3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF028706
GeneCard ID ZIC3
GenAtlas ID ZIC3
HGNC ID HGNC:12874
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Gebbia M, Ferrero GB, Pilia G, Bassi MT, Aylsworth A, Penman-Splitt M, Bird LM, Bamforth JS, Burn J, Schlessinger D, Nelson DL, Casey B: X-linked situs abnormalities result from mutations in ZIC3. Nat Genet. 1997 Nov;17(3):305-8. [PubMed:9354794 ]
  5. Ware SM, Peng J, Zhu L, Fernbach S, Colicos S, Casey B, Towbin J, Belmont JW: Identification and functional analysis of ZIC3 mutations in heterotaxy and related congenital heart defects. Am J Hum Genet. 2004 Jan;74(1):93-105. Epub 2003 Dec 16. [PubMed:14681828 ]
  6. Chhin B, Hatayama M, Bozon D, Ogawa M, Schon P, Tohmonda T, Sassolas F, Aruga J, Valard AG, Chen SC, Bouvagnet P: Elucidation of penetrance variability of a ZIC3 mutation in a family with complex heart defects and functional analysis of ZIC3 mutations in the first zinc finger domain. Hum Mutat. 2007 Jun;28(6):563-70. [PubMed:17295247 ]