You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10925
Secondary Accession Numbers
  • 17226
Name Zinc finger protein 828
Synonyms Not Available
Gene Name ZNF828
Protein Type Unknown
Biological Properties
General Function Involved in zinc ion binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 13q34
SNPs ZNF828
Gene Sequence
>2439 bp
ATGGAAGCATTCCAGGAACTTCGTAAACCATCAGCACGTTTGGAGTGTGACCATTGCAGT
TTCAGAGGCACAGACTATGAAAATGTACAAATCCATATGGGTACCATCCATCCAGAATTT
TGTGATGAAATGGATGCTGGTGGGCTAGGCAAAATGATATTTTACCAGAAAAGTGCAAAG
TTATTTCACTGCCATAAATGCTTCTTCACCAGCAAGATGTACTCTAATGTATACTATCAC
ATCACATCCAAACATGCATCCCCAGACAAATGGAATGATAAACCAAAAAATCAGTTGAAC
AAAGAAACAGATCCTGTGAAAAGCCCTCCTCTTCCTGAACACCAGAAAATACCCTGCAAT
TCAGCAGAACCAAAATCCATACCTGCCCTTTCAATGGAAACACAGAAACTTGGTTCAGTT
TTGTCTCCAGAATCGCCAAAACCTACTCCTCTTACTCCCCTGGAGCCTCAGAAACCTGGC
TCTGTTGTTTCTCCTGAGCTACAGACACCTCTTCCTTCTCCTGAGCCTTCAAAACCTGCC
TCTGTTTCTTCTCCTGAACCTCCAAAATCAGTCCCTGTTTGTGAGTCTCAGAAACTTGCC
CCTGTTCCTTCTCCAGAACCACAGAAACCTGCCCCTGTATCTCCTGAGTCAGTAAAGGCT
ACTCTTAGTAATCCCAAACCCCAGAAGCAGTCTCATTTCCCGGAAACATTGGGGCCACCT
TCAGCCTCATCTCCAGAGTCACCAGTTCTAGCTGCTTCCCCAGAACCTTGGGGACCATCC
CCAGCTGCATCTCCAGAATCTCGGAAGTCAGCCCGGACTACCTCCCCTGAGCCAAGGAAG
CCATCCCCTTCAGAGTCTCCTGAACCTTGGAAGCCGTTCCCTGCTGTCTCCCCAGAGCCT
AGGAGACCAGCCCCCGCTGTGTCACCAGGCTCTTGGAAACCAGGGCCACCTGGGTCCCCT
AGGCCTTGGAAATCCAATCCTTCAGCATCATCAGGACCTTGGAAGCCAGCTAAACCTGCT
CCATCTGTGTCTCCTGGACCTTGGAAACCAATTCCTTCTGTATCTCCTGGACCTTGGAAA
CCAACTCCATCTGTGTCTTCTGCATCCTGGAAATCTTCATCAGTCTCACCCAGCTCCTGG
AAGTCTCCCCCTGCATCTCCTGAGTCATGGAAGTCTGGCCCACCAGAACTCCGAAAGACA
GCTCCCACGTTGTCTCCTGAACATTGGAAGGCAGTTCCCCCAGTGTCTCCAGAGCTTCGC
AAACCCGGCCCACCACTATCCCCAGAGATCCGTAGTCCAGCAGGATCTCCAGAGCTCAGA
AAACCCTCAGGGTCACCAGATCTTTGGAAGCTTTCTCCTGATCAGCGGAAAACTTCTCCT
GCTTCACTTGATTTCCCTGAGTCCCAGAAAAGTTCCCGTGGTGGTTCTCCTGATCTCTGG
AAGTCTTCCTTTTTTATTGAGCCTCAGAAACCTGTCTTCCCTGAGACCCGAAAACCAGGT
CCTTCTGGGCCATCTGAGTCCCCCAAAGCAGCCTCAGATATCTGGAAGCCTGTTCTCTCT
ATCGATACTGAGCCTAGAAAACCTGCCCTGTTTCCCGAGCCTGCCAAAACAGCCCCTCCT
GCTTCTCCAGAAGCACGCAAACGTGCCCTTTTTCCAGAGCCCCGGAAGCATGCCCTTTTC
CCTGAACTCCCCAAATCTGCTCTATTCTCAGAATCACAGAAGGCTGTTGAGCTTGGTGAT
GAACTACAAATAGATGCCATAGATGATCAAAAATGTGATATTTTGGTTCAGGAAGAACTT
CTAGCTTCACCTAAGAAACTCTTAGAAGATACTTTATTTCCTTCCTCAAAGAAGCTCAAG
AAAGACAACCAAGAGAGCTCAGACGCTGAGCTTAGTAGTAGTGAGTACATAAAAACAGAT
TTGGATGCGATGGATATTAAGGGCCAGGAATCAAGCAGTGATCAAGAGCAGGTTGATGTG
GAATCCATTGATTTTAGCAAAGAGAACAAAATGGACATGACTAGTCCAGAGCAGTCTAGA
AATGTGCTACAGTTTACTGAAGAAAAAGAAGCTTTTATCTCTGAAGAGGAGATTGCAAAA
TACATGAAGCGTGGAAAAGGAAAGTATTATTGCAAAATTTGTTGCTGTCGTGCTATGAAA
AAAGGTGCTGTTTTGCATCATTTGGTTAATAAGCATAATGTTCATAGCCCTTACAAATGC
ACAATCTGTGGAAAGGCTTTTCTTTTGGAATCTCTCCTTAAAAATCATGTAGCAGCCCAT
GGGCAAAGTTTACTTAAATGTCCACGTTGTAATTTTGAATCAAATTTCCCAAGAGGTTTT
AAGAAACATTTAACTCATTGTCAAAGCCGGCATAATGAAGAGGCAAATAAAAAGCTAATG
GAAGCTCTTGAACCGCCACTGGAGGAGCAGCAAATTTGA
Protein Properties
Number of Residues 812
Molecular Weight 89098.2
Theoretical pI 8.63
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein 828
MEAFQELRKPSARLECDHCSFRGTDYENVQIHMGTIHPEFCDEMDAGGLGKMIFYQKSAK
LFHCHKCFFTSKMYSNVYYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLPEHQKIPCN
SAEPKSIPALSMETQKLGSVLSPESPKPTPLTPLEPQKPGSVVSPELQTPLPSPEPSKPA
SVSSPEPPKSVPVCESQKLAPVPSPEPQKPAPVSPESVKATLSNPKPQKQSHFPETLGPP
SASSPESPVLAASPEPWGPSPAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEP
RRPAPAVSPGSWKPGPPGSPRPWKSNPSASSGPWKPAKPAPSVSPGPWKPIPSVSPGPWK
PTPSVSSASWKSSSVSPSSWKSPPASPESWKSGPPELRKTAPTLSPEHWKAVPPVSPELR
KPGPPLSPEIRSPAGSPELRKPSGSPDLWKLSPDQRKTSPASLDFPESQKSSRGGSPDLW
KSSFFIEPQKPVFPETRKPGPSGPSESPKAASDIWKPVLSIDTEPRKPALFPEPAKTAPP
ASPEARKRALFPEPRKHALFPELPKSALFSESQKAVELGDELQIDAIDDQKCDILVQEEL
LASPKKLLEDTLFPSSKKLKKDNQESSDAELSSSEYIKTDLDAMDIKGQESSSDQEQVDV
ESIDFSKENKMDMTSPEQSRNVLQFTEEKEAFISEEEIAKYMKRGKGKYYCKICCCRAMK
KGAVLHHLVNKHNVHSPYKCTICGKAFLLESLLKNHVAAHGQSLLKCPRCNFESNFPRGF
KKHLTHCQSRHNEEANKKLMEALEPPLEEQQI
GenBank ID Protein 255918139
UniProtKB/Swiss-Prot ID Q96JM3
UniProtKB/Swiss-Prot Entry Name ZN828_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001164144.1
GeneCard ID ZNF828
GenAtlas ID ZNF828
HGNC ID HGNC:20311
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  9. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  10. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  11. Nagase T, Nakayama M, Nakajima D, Kikuno R, Ohara O: Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2001 Apr 27;8(2):85-95. [PubMed:11347906 ]
  12. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  13. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  14. Kim JE, Tannenbaum SR, White FM: Global phosphoproteome of HT-29 human colon adenocarcinoma cells. J Proteome Res. 2005 Jul-Aug;4(4):1339-46. [PubMed:16083285 ]
  15. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]