You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10926
Secondary Accession Numbers
  • 17227
Name Zinc finger protein 64 homolog, isoforms 3 and 4
Synonyms
  1. Zfp-64
  2. Zinc finger protein 338
Gene Name ZFP64
Protein Type Unknown
Biological Properties
General Function Involved in zinc ion binding
Specific Function May be involved in transcriptional regulation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
Cellular Location
  1. Nucleus (Probable)
Gene Properties
Chromosome Location Chromosome:2
Locus 20q13.2
SNPs ZFP64
Gene Sequence
>1938 bp
ATGAACGCGAGCAGCGAGGGCGAGAGCTTCGCGGGCTCGGTGCAAATTCCAGGTGGCACA
ACGGTGCTGGTGGAGCTGACTCCCGACATCCATATCTGCGGCATCTGCAAGCAGCAGTTT
AACAACCTGGATGCCTTTGTAGCTCACAAGCAAAGTGGCTGCCAGCTGACAGGCACATCC
GCAGCAGCCCCCAGCACGGTCCAGTTTGTATCGGAGGAAACAGTGCCTGCCACCCAGACT
CAGACCACCACCAGAACCATCACCTCGGAGACCCAGACAATCACAGTTTCAGCTCCAGAA
TTTGTTTTTGAACATGGCTATCAAACTTACCTGCCCACGGAAAGTAATGAAAACCAGACA
GCCACTGTCATCTCTCTCCCTGCCAAGTCACGCACCAAAAAGCCCACAACACCACCTGCT
CAGAAAAGGCTTAACTGTTGCTATCCAGGTTGCCAATTCAAGACTGCTTATGGCATGAAG
GACATGGAGCGGCATTTAAAAATTCACACGGGAGACAAACCCCATAAGTGTGAAGTCTGT
GGCAAGTGCTTTAGCCGGAAAGACAAGCTGAAAACTCACATGCGGTGCCACACGGGCGTG
AAGCCCTACAAGTGTAAGACGTGTGACTACGCCGCTGCCGACAGCAGCAGCCTCAACAAG
CACCTGAGGATCCACTCGGACGAGCGGCCCTTCAAATGCCAGATCTGCCCCTACGCCAGC
CGCAACTCCAGCCAGCTCACTGTCCACCTGCGATCCCACACGGCTTCAGAACTTGATGAT
GATGTTCCAAAAGCAAACTGCCTCTCCACTGAAAGCACTGACACTCCGAAGGCCCCTGTC
ATCACTCTTCCCTCAGAGGCAAGGGAACAAATGGCCACCCTTGGAGAGAGGACGTTCAAC
TGTTGCTACCCAGGTTGCCACTTCAAAACTGTCCATGGCATGAAAGACTTGGACCGCCAT
CTCAGAATCCACACGGGAGACAAACCGCACAAGTGTGAGTTCTGTGACAAGTGCTTCAGC
CGGAAGGACAACCTGACCATGCACATGCGGTGCCACACCAGTGTGAAGCCACACAAGTGT
CACCTGTGTGACTACGCTGCCGTGGACAGCAGTAGCCTCAAGAAGCACCTGCGGATCCAC
TCTGATGAGCGGCCGTACAAATGCCAGCTCTGCCCCTATGCCAGCCGCAACTCCAGCCAG
CTCACCGTCCACCTGCGATCTCACACGGGGGATACCCCCTTCCAGTGCTGGCTCTGTAGC
GCCAAGTTCAAAATCAGCTCGGACTTGAAAAGGCACATGATCGTGCACTCGGGGGAGAAG
CCTTTCAAGTGCGAGTTCTGCGACGTCCGCTGCACCATGAAGGCGAATCTCAAATCGCAC
ATCCGCATCAAGCACACCTTCAAATGTCTGCACTGTGCCTTCCAGGGCCGGGACCGGGCT
GACCTCCTGGAGCACAGCCGGCTGCACCAGGCCGACCACCCGGAGAAGTGTCCAGAGTGC
AGCTACTCCTGCTCCAGCGCGGCCGCCCTGCGCGTGCACAGCAGAGTCCACTGTAAGGAC
CGTCCCTTCAAGTGTGACTTCTGCAGCTTCGACACGAAGCGGCCCAGCAGCCTGGCCAAG
CACGTCGACAAGGTGCACAGGGACGAGGCCAAGACGGAGAACCGGGCCCCTCTGGGCAAG
GAAGGGCTCAGAGAGGGCAGCTCCCAGCACGTGGCCAAGATCGTGACGCAGAGGGCCTTC
CGCTGTGAGACCTGCGGCGCCTCCTTCGTCAGGGATGACTCTCTGAGATGCCACAAGAAG
CAGCACAGTGATCAGAGTGAGAACAAGAACTCAGACTTGGTCACCTTCCCACCGGAAAGC
GGTGCCTCGGGACAGCTCAGCACCCTGGTCTCCGTGGGGCAGCTCGAGGCTCCCCTAGAG
CCCAGCCAAGACCTCTAG
Protein Properties
Number of Residues 645
Molecular Weight 72216.3
Theoretical pI 8.48
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein 64 homolog, isoforms 3 and 4
MNASSEGESFAGSVQIPGGTTVLVELTPDIHICGICKQQFNNLDAFVAHKQSGCQLTGTS
AAAPSTVQFVSEETVPATQTQTTTRTITSETQTITVSAPEFVFEHGYQTYLPTESNENQT
ATVISLPAKSRTKKPTTPPAQKRLNCCYPGCQFKTAYGMKDMERHLKIHTGDKPHKCEVC
GKCFSRKDKLKTHMRCHTGVKPYKCKTCDYAAADSSSLNKHLRIHSDERPFKCQICPYAS
RNSSQLTVHLRSHTASELDDDVPKANCLSTESTDTPKAPVITLPSEAREQMATLGERTFN
CCYPGCHFKTVHGMKDLDRHLRIHTGDKPHKCEFCDKCFSRKDNLTMHMRCHTSVKPHKC
HLCDYAAVDSSSLKKHLRIHSDERPYKCQLCPYASRNSSQLTVHLRSHTGDTPFQCWLCS
AKFKISSDLKRHMIVHSGEKPFKCEFCDVRCTMKANLKSHIRIKHTFKCLHCAFQGRDRA
DLLEHSRLHQADHPEKCPECSYSCSSAAALRVHSRVHCKDRPFKCDFCSFDTKRPSSLAK
HVDKVHRDEAKTENRAPLGKEGLREGSSQHVAKIVTQRAFRCETCGASFVRDDSLRCHKK
QHSDQSENKNSDLVTFPPESGASGQLSTLVSVGQLEAPLEPSQDL
GenBank ID Protein 162417982
UniProtKB/Swiss-Prot ID Q9NTW7
UniProtKB/Swiss-Prot Entry Name ZF64B_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_199427.2
GeneCard ID ZFP64
GenAtlas ID ZFP64
HGNC ID HGNC:15940
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]