You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10930
Secondary Accession Numbers
  • 17235
Name Zinc finger protein 219
Synonyms Not Available
Gene Name ZNF219
Protein Type Unknown
Biological Properties
General Function Involved in histamine receptor activity
Specific Function May be involved in transcriptional regulation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
receptor activity
transmembrane receptor activity
histamine receptor activity
molecular transducer activity
signal transducer activity
nucleic acid binding
g-protein coupled receptor activity
g-protein coupled amine receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 14q11
SNPs ZNF219
Gene Sequence
>2169 bp
ATGGAGGGCTCACGTCCCCGCGCCCCGAGCGGCCACTTAGCGCCGTCGCCGCCGGCTTTC
GACGGCGAGCTGGATCTGCAGCGATACTCCAACGGGCCAGCCGTGAGCGCAGGGTCGCTC
GGGATGGGAGCGGTGAGCTGGTCTGAGAGTCGTGCAGGCGAACGGCGCTTCCCCTGCCCT
GTATGCGGGAAGCGCTTCCGCTTCAACTCTATCCTTGCTTTGCACCTGCGGGCGCACCCA
GGAGCCCAGGCCTTCCAGTGCCCTCACTGCGGCCACCGCGCGGCGCAGCGGGCTCTGCTG
CGCTCGCACCTGCGCACACACCAGCCCGAGCGCCCACGTAGTCCTGCTGCACGCCTGTTG
CTGGAGTTGGAAGAGCGCGCGCTACTACGCGAGGCCCGACTGGGGAGAGCCCGAAGCTCA
GGGGGCATGCAGGCCACCCCTGCCACTGAGGGTCTGGCGCGGCCCCAGGCTCCTTCATCG
TCCGCCTTCCGTTGCCCCTACTGCAAAGGCAAGTTTCGCACCTCGGCGGAGCGCGAACGC
CACCTGCACATCCTGCATAGGCCCTGGAAGTGCGGCCTGTGCAGTTTCGGCTCCAGCCAG
GAGGAGGAGCTGCTGCACCACAGCCTGACGGCCCACGGGGCTCCCGAGCGTCCCCTGGCG
GCCACCTCCGCTGCGCCTCCGCCTCAGCCTCAGCCTCAGCCTCCACCCCAGCCCGAACCC
AGATCAGTCCCCCAGCCGGAGCCGGAGCCGGAGCCCGAACGTGAGGCAACCCCGACCCCA
GCTCCTGCCGCTCCCGAGGAGCCCCCAGCGCCTCCGGAGTTCCGCTGCCAAGTGTGCGGC
CAGAGCTTTACACAGTCTTGGTTTCTCAAGGGCCACATGCGTAAGCACAAGGCCTCCTTC
GATCATGCGTGTCCGGTGTGCGGCCGCTGCTTCAAGGAGCCCTGGTTCCTTAAGAACCAC
ATGAAGGTGCACGCCAGCAAGCTGGGCCCACTGCGTGCCCCGGGGCCTGCCTCCGGGCCT
GCCCGCGCCCCCCAGCCTCCTGACCTCGGCCTGCTGGCCTATGAGCCGTTGGGCCCAGCG
CTCCTCTTGGCCCCGGCTCCCACCCCGGCCGAGCGCCGTGAGCCCCCGAGCCTCTTGGGC
TACCTGAGCCTGCGAGCTGGCGAGGGCCGGCCCAACGGCGAGGGTGCTGAGCCCGGTCCC
GGCCGCAGCTTCGGAGGCTTCCGCCCGCTGTCCTCTGCTCTCCCGGCCCGGGCTCGCCGG
CACCGTGCGGAGGAGCCTGAGGAAGAAGAGGAGGTGGTGGAGGCCCAGGAGGAAACCTGG
GCCCGGGGCAGGTCGCTGGGCTCTCTGGCTTCCCTGCACCCGCGCCCGGGTGAGGGACCG
GGGCACTCTGCCTCTGCTGCTGGGGCCCAGGCAAGATCGACCGCCACGCAGGAAGAGAAT
GGGCTGTTGGTTGGAGGGACCCGGCCTGAAGGGGGCCGGGGCGCCACCGGCAAGGATTGT
CCTTTCTGCGGAAAATCTTTCCGCTCAGCACATCACCTCAAAGTGCATCTGCGAGTGCAC
ACAGGCGAGCGGCCCTACAAGTGTCCGCACTGCGACTACGCGGGCACCCAGTCCGGCTCG
CTCAAGTATCACCTACAGCGCCACCACCGGGAGCAGAGGAGCGGGGCCGGCCCCGGGCCA
CCCCCGGAGCCACCGCCTCCTTCCCAGCGGGGTTCGGCCCCGCAATCTGGAGCCAAGCCG
TCTCCGCAGCCTGCGACCTGGGTGGAGGGCGCCTCAAGTCCCCGGCCTCCTTCTAGCGGT
GCTGGGCCGGGGTCCCGTCGGAAGCCCGCCAGCCCTGGGAGGACCCTGCGCAACGGGCGA
GGCGGTGAGGCCGAACCCCTGGACCTGTCCTTGCGGGCAGGGCCGGGAGGCGAGGCCGGG
CCTGGGGGTGCCCTCCACCGCTGCCTCTTCTGCCCGTTCGCCACTGGAGCCCCAGAGCTC
ATGGCCTTGCACCTTCAAGTGCACCACAGCCGCCGGGCTAGGGGCCGCCGGCCACCCCAG
GCTGACGCGTCCCCGCCCTATGCCCGAGTACCATCAGGAGAGACCCCTCCCAGTCCTTCG
CAGGAAGGGGAGGAGGGCTCCGGGCTGTCCAGACCCGGAGAGGCAGGGCTGGGGGGGCAA
GAACGGTAG
Protein Properties
Number of Residues 722
Molecular Weight 76876.5
Theoretical pI 9.75
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein 219
MEGSRPRAPSGHLAPSPPAFDGELDLQRYSNGPAVSAGSLGMGAVSWSESRAGERRFPCP
VCGKRFRFNSILALHLRAHPGAQAFQCPHCGHRAAQRALLRSHLRTHQPERPRSPAARLL
LELEERALLREARLGRARSSGGMQATPATEGLARPQAPSSSAFRCPYCKGKFRTSAERER
HLHILHRPWKCGLCSFGSSQEEELLHHSLTAHGAPERPLAATSAAPPPQPQPQPPPQPEP
RSVPQPEPEPEPEREATPTPAPAAPEEPPAPPEFRCQVCGQSFTQSWFLKGHMRKHKASF
DHACPVCGRCFKEPWFLKNHMKVHASKLGPLRAPGPASGPARAPQPPDLGLLAYEPLGPA
LLLAPAPTPAERREPPSLLGYLSLRAGEGRPNGEGAEPGPGRSFGGFRPLSSALPARARR
HRAEEPEEEEEVVEAEEETWARGRSLGSLASLHPRPGEGPGHSASAAGAQARSTATQEEN
GLLVGGTRPEGGRGATGKDCPFCGKSFRSAHHLKVHLRVHTGERPYKCPHCDYAGTQSGS
LKYHLQRHHREQRSGAGPGPPPEPPPPSQRGSAPQSGAKPSPQPATWVEGASSPRPPSSG
AGPGSRRKPASPGRTLRNGRGGEAEPLDLSLRAGPGGEAGPGGALHRCLFCPFATGAPEL
MALHLQVHHSRRARGRRPPQADASPPYARVPSGETPPSPSQEGEEGSGLSRPGEAGLGGQ
ER
GenBank ID Protein 6899807
UniProtKB/Swiss-Prot ID Q9P2Y4
UniProtKB/Swiss-Prot Entry Name ZN219_HUMAN
PDB IDs Not Available
GenBank Gene ID AB015427
GeneCard ID ZNF219
GenAtlas ID ZNF219
HGNC ID HGNC:13011
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  3. Sakai T, Toyoda A, Hashimoto K, Maeda H: Isolation and characterization of a novel zinc finger gene, ZNF219, and mapping to the human chromosome 14q11 region. DNA Res. 2000 Apr 28;7(2):137-41. [PubMed:10819330 ]