Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10933
Secondary Accession Numbers
  • 17238
Name Poly(U)-binding-splicing factor PUF60
Synonyms
  1. 60 kDa poly(U)-binding-splicing factor
  2. FBP-interacting repressor
  3. FUSE-binding protein-interacting repressor
  4. Ro-binding protein 1
  5. RoBP1
  6. Siah-BP1
  7. Siah-binding protein 1
Gene Name PUF60
Protein Type Unknown
Biological Properties
General Function Involved in nucleotide binding
Specific Function DNA- and RNA-binding protein, involved in several nuclear processes such as pre-mRNA splicing, apoptosis and transcription regulation. In association with FUBP1 regulates MYC transcription at the P2 promoter through the core-TFIIH basal transcription factor. Acts as a transcriptional repressor through the core-TFIIH basal transcription factor. Represses FUBP1-induced transcriptional activation but not basal transcription. Decreases ERCC3 helicase activity. Does not repress TFIIH-mediated transcription in xeroderma pigmentosum complementation group B (XPB) cells. Is also involved in pre-mRNA splicing. Promotes splicing of an intron with weak 3'-splice site and pyrimidine tract in a cooperative manner with U2AF2. Involved in apoptosis induction when overexpressed in HeLa cells. Isoform 6 failed to repress MYC transcription and inhibited FIR-induced apoptosis in colorectal cancer. Isoform 6 may contribute to tumor progression by enabling increased MYC expression and greater resistance to apoptosis in tumors than in normal cells. Modulates alternative splicing of several mRNAs. Binds to relaxed DNA of active promoter regions. Binds to the pyrimidine tract and 3'-splice site regions of pre-mRNA; binding is enhanced in presence of U2AF2. Binds to Y5 RNA in association with TROVE2. Binds to poly(U) RNA
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
nucleotide binding
nucleic acid binding
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:8
Locus 8q24.3
SNPs PUF60
Gene Sequence
>1680 bp
ATGGCGACGGCGACCATAGCTCTCCAGGTCAATGGCCAGCAAGGAGGGGGGTCCGAGCCG
GCGGCGGCGGCGGCAGTGGTGGCAGCGGGAGACAAATGGAAACCTCCACAGGGCACAGAC
TCCATCAAGATGGAGAACGGGCAGAGCACAGCCGCCAAGCTGGGGCTGCCTCCCCTGACG
CCCGAGCAGCAGGAGGCCCTTCAGAAGGCCAAGAAGTACGCCATGGAGCAGAGCATCAAG
AGTGTGCTGGTGAAGCAGACCATCGCGCACCAGCAGCAGCAGCTCACCAACCTGCAGATG
GCAGCAGTGACAATGGGCTTTGGAGATCCTCTCTCACCTTTGCAATCGATGGCGGCTCAG
CGGCAGCGAGCGCTGGCCATCATGTGCCGCGTCTACGTGGGCTCTATCTACTATGAGCTG
GGGGAGGACACCATCCGCCAGGCCTTTGCCCCCTTTGGCCCCATCAAGAGCATCGACATG
TCCTGGGACTCCGTCACCATGAAGCACAAGGGCTTTGCCTTCGTGGAGTATGAGGTCCCC
GAAGCTGCACAGCTGGCCTTGGAGCAGATGAACTCGGTGATGCTGGGGGGCAGGAACATC
AAGGTGGGCAGACCCAGCAACATAGGGCAGGCCCAGCCCATCATAGACCAGTTGGCTGAG
GAGGCACGGGCCTTCAACCGCATCTACGTGGCCTCTGTGCACCAGGACCTCTCAGACGAT
GACATCAAGAGCGTGTTTGAGGCCTTTGGCAAGATCAAGTCCTGCACACTGGCCCGGGAC
CCCACAACTGGCAAGCACAAGGGCTACGGCTTCATTGAGTACGAGAAGGCCCAGTCGTCC
CAAGATGCTGTGTCTTCCATGAACCTCTTTGACCTGGGTGGCCAGTACTTGCGGGTGGGC
AAGGCTGTCACACCGCCCATGCCCCTACTCACACCAGCCACGCCTGGAGGCCTCCCACCT
GCCGCTGCTGTGGCAGCTGCTGCAGCCACTGCCAAGATCACAGCTCAGGAAGCAGTGGCC
GGAGCAGCGGTGCTGGGTACCCTGGGCACACCTGGACTGGTGTCCCCAGCACTGACCCTG
GCCCAGCCCCTGGGCACTTTGCCCCAGGCTGTCATGGCTGCCCAGGCACCTGGAGTCATC
ACAGGTGTGACCCCAGCCCGTCCTCCTATCCCGGTCACCATCCCCTCGGTGGGAGTGGTG
AACCCCATCCTGGCCAGCCCTCCAACGCTGGGTCTCCTGGAGCCCAAGAAGGAGAAGGAA
GAAGAGGAGCTGTTTCCCGAGTCAGAGCGGCCAGAGATGCTGAGCGAGCAGGAGCACATG
AGCATCTCGGGCAGTAGCGCCCGACACATGGTGATGCAGAAGCTGCTCCGCAAGCAGGAG
TCTACAGTGATGGTTCTGCGCAACATGGTGGACCCCAAGGACATCGATGATGACCTGGAA
GGGGAGGTGACAGAGGAGTGTGGCAAGTTCGGGGCCGTGAACCGCGTCATCATCTACCAA
GAGAAACAAGGCGAGGAGGAGGATGCAGAAATCATTGTCAAGATCTTTGTGGAGTTTTCC
ATAGCCTCTGAGACTCATAAGGCCATCCAGGCCCTCAATGGCCGCTGGTTTGCTGGCCGC
AAGGTGGTGGCTGAAGTGTACGACCAGGAGCGTTTTGATAACAGTGACCTCTCTGCGTGA
Protein Properties
Number of Residues 559
Molecular Weight 59875.0
Theoretical pI 4.95
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Poly(U)-binding-splicing factor PUF60
MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLT
PEQQEALQKAKKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQ
RQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVP
EAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDD
DIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVG
KAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLGTPGLVSPALTL
AQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKE
EEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLE
GEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGR
KVVAEVYDQERFDNSDLSA
GenBank ID Protein 6684440
UniProtKB/Swiss-Prot ID Q9UHX1
UniProtKB/Swiss-Prot Entry Name PUF60_HUMAN
PDB IDs Not Available
GenBank Gene ID AF114818
GeneCard ID PUF60
GenAtlas ID PUF60
HGNC ID HGNC:17042
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  7. Liu J, He L, Collins I, Ge H, Libutti D, Li J, Egly JM, Levens D: The FBP interacting repressor targets TFIIH to inhibit activated transcription. Mol Cell. 2000 Feb;5(2):331-41. [PubMed:10882074 ]
  8. Bouffard P, Barbar E, Briere F, Boire G: Interaction cloning and characterization of RoBPI, a novel protein binding to human Ro ribonucleoproteins. RNA. 2000 Jan;6(1):66-78. [PubMed:10668799 ]
  9. Page-McCaw PS, Amonlirdviman K, Sharp PA: PUF60: a novel U2AF65-related splicing activity. RNA. 1999 Dec;5(12):1548-60. [PubMed:10606266 ]
  10. Liu J, Akoulitchev S, Weber A, Ge H, Chuikov S, Libutti D, Wang XW, Conaway JW, Harris CC, Conaway RC, Reinberg D, Levens D: Defective interplay of activators and repressors with TFIH in xeroderma pigmentosum. Cell. 2001 Feb 9;104(3):353-63. [PubMed:11239393 ]
  11. Matsushita K, Tomonaga T, Shimada H, Shioya A, Higashi M, Matsubara H, Harigaya K, Nomura F, Libutti D, Levens D, Ochiai T: An essential role of alternative splicing of c-myc suppressor FUSE-binding protein-interacting repressor in carcinogenesis. Cancer Res. 2006 Feb 1;66(3):1409-17. [PubMed:16452196 ]
  12. Liu J, Kouzine F, Nie Z, Chung HJ, Elisha-Feil Z, Weber A, Zhao K, Levens D: The FUSE/FBP/FIR/TFIIH system is a molecular machine programming a pulse of c-myc expression. EMBO J. 2006 May 17;25(10):2119-30. Epub 2006 Apr 20. [PubMed:16628215 ]
  13. Hastings ML, Allemand E, Duelli DM, Myers MP, Krainer AR: Control of pre-mRNA splicing by the general splicing factors PUF60 and U2AF(65). PLoS One. 2007 Jun 20;2(6):e538. [PubMed:17579712 ]