Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10942
Secondary Accession Numbers
  • 17255
Name Protein FAN
Synonyms
  1. Factor associated with N-SMase activation
  2. Factor associated with neutral sphingomyelinase activation
Gene Name NSMAF
Protein Type Enzyme
Biological Properties
General Function Involved in receptor signaling protein activity
Specific Function Couples the p55 TNF-receptor (TNF-R55 / TNFR1) to neutral sphingomyelinase (N-SMASE). Specifically binds to the N- smase activation domain of TNF-R55. May regulate ceramide production by N-SMASE
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:8
Locus 8q12-q13
SNPs NSMAF
Gene Sequence
>2754 bp
ATGGCGTTTATCCGGAAGAAGCAGCAGGAGCAGCAGCTGCAGCTCTACTCCAAGGAGAGA
TTTTCCTTGCTGCTGCTTAACTTGGAGGAGTACTACTTTGAACAGCATAGAGCCAATCAC
ATTTTGCACAAGGGCAGTCACCATGAAAGGAAAATCAGAGGCTCCTTAAAAATATGTTCA
AAATCGGTGATTTTTGAACCAGATTCAATATCCCAGCCCATCATCAAGATTCCTTTGAGA
GACTGTATAAAAATAGGAAAGCATGGAGAAAATGGAGCCAATAGACACTTCACAAAGGCA
AAATCTGGGGGTATTTCACTCATTTTCAGTCAGGTATATTTCATTAAAGAACATAATGTT
GTTGCACCATATAAAATAGAAAGGGGCAAAATGGAATATGTTTTTGAATTGGATGTTCCC
GGGAAAGTGGAAGATGTTGTGGAGACGTTGCTTCAGCTTCACAGAGCATCCTGCCTTGAC
AAATTGGGTGACCAAACCGCCATGATAACAGCTATTTTGCAGTCTCGTTTAGCTAGAACA
TCATTTGACAAAAACAGGTTCCAAAACATTTCTGAAAAGCTGCACATGGAATGCAAAGCA
GAAATGGTGACGCCTCTGGTGACTAATCCTGGACACGTGTGCATCACGGACACAAACCTG
TATTTTCAGCCCCTCAACGGCTACCCGAAACCTGTGGTCCAGATAACACTCCAAGATGTC
CGCCGCATCTACAAAAGGAGGCACGGCCTCATGCCTCTGGGCTTGGAAGTATTTTGCACA
GAAGATGATCTGTGTTCCGACATCTACCTAAAGTTCTATGAACCTCAAGATAGAGATGAT
CTCTATTTTTACATTGCCACATACCTAGAGCACCATGTGGCGGAGCACACTGCTGAGAGC
TACATGCTGCAGTGGCAGCGTGGACACCTTTCCAACTATCAGTACCTCCTTCACCTCAAC
AACCTGGCCGACCGCAGCTGCAACGACCTCTCCCAGTACCCTGTGTTTCCATGGATAATA
CATGATTATTCCAGCTCAGAACTAGATTTGTCAAATCCAGGAACCTTCCGGGATCTCAGT
AAGCCAGTAGGGGCCCTAAATAAGGAACGGCTGGAGAGACTACTGACACGCTACCAGGAA
ATGCCTGAACCAAAGTTCATGTATGGGAGTCACTACTCTTCCCCGGGTTATGTACTTTTT
TATCTTGTTAGGATTGCACCAGAGTATATGCTGTGCCTGCAGAATGGAAGATTTGATAAT
GCAGATAGAATGTTCAACAGTATTGCAGAAACTTGGAAAAACTGTCTGGATGGTGCAACG
GATTTTAAAGAGTTAATTCCAGAATTCTATGGTGATGATGTGAGCTTTCTAGTCAATAGC
CTGAAGTTGGATTTGGGAAAGAGACAAGGAGGACAGATGGTTGACGATGTGGAGCTTCCC
CCTTGGGCTTCCAGTCCCGAGGACTTTCTCCAGAAGAGCAAAGATGCATTGGAAAGCAAT
TATGTGTCTGAACACCTTCACGAGTGGATTGATCTAATATTTGGCTACAAACAAAAAGGG
AGTGATGCAGTTGGGGCCCATAATGTATTTCATCCCCTGACCTATGAAGGAGGTGTAGAC
TTGAACAGCATCCAGGATCCTGATGAGAAGGTAGCCATGCTTACGCAAATCTTGGAATTT
GGGCAGACACCAAAACAACTATTTGTGACACCACATCCTCGAAGGATCACCCCAAAGTTT
AAAAGTTTGTCCCAGACCTCCAGTTATAATGCTTCTATGGCAGATTCCCCAGGTGAAGAG
TCTTTTGAAGACCTGACCGAAGAAAGCAAAACACTGGCCTGGAATAACATCACCAAACTG
CAGTTACACGAGCACTATAAAATCCACAAAGAAGCAGTTACTGGAATCACGGTCTCTCGC
AATGGATCTTCAGTATTCACAACATCCCAAGATTCCACCTTGAAGATGTTTTCTAAAGAA
TCAAAAATGCTACAAAGAAGTATATCATTTTCAAATATGGCTTTATCGTCTTGTTTACTT
TTACCAGGAGATGCCACTGTCATAACTTCTTCATGGGATAATAATGTCTATTTTTATTCC
ATAGCATTTGGAAGACGCCAGGACACGTTAATGGGACATGATGATGCTGTTAGTAAGATC
TGTTGGCATGACAACAGGCTATATTCTGCATCGTGGGACTCTACAGTGAAGGTGTGGTCT
GGTGTTCCTGCAGAGATGCCAGGCACCAAAAGACACCACTTTGACTTGCTGGCCGAGCTG
GAACATGATGTCAGTGTAGATACAATCAGTTTAAATGCTGCAAGCACACTGTTAGTTTCC
GGCACCAAAGAAGGCACAGTGAATATTTGGGACCTCACAACGGCCACCTTAATGCACCAG
ATTCCATGCCATTCAGGGATTGTATGTGACACTGCTTTTAGCCCAGATAGTCGCCATGTC
CTCAGCACAGGAACAGATGGCTGTCTTAATGTCATTGATGTGCAGACAGGAATGCTCATC
TCCTCCATGACATCAGATGAGCCCCAGAGGTGCTTTGTCTGGGATGGAAATTCCGTTTTA
TCTGGCAGTCAGTCTGGTGAACTGCTCGTTTGGGACCTCCTTGGAGCAAAAATCAGTGAG
AGAATACAGGGCCACACAGGTGCTGTGACATGTATATGGATGAATGAACAGTGTAGCAGT
ATCATCACAGGAGGGGAAGACAGACAAATTATATTCTGGAAATTGCAGTATTAA
Protein Properties
Number of Residues 917
Molecular Weight 104371.5
Theoretical pI 6.18
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Protein FAN
MAFIRKKQQEQQLQLYSKERFSLLLLNLEEYYFEQHRANHILHKGSHHERKIRGSLKICS
KSVIFEPDSISQPIIKIPLRDCIKIGKHGENGANRHFTKAKSGGISLIFSQVYFIKEHNV
VAPYKIERGKMEYVFELDVPGKVEDVVETLLQLHRASCLDKLGDQTAMITAILQSRLART
SFDKNRFQNISEKLHMECKAEMVTPLVTNPGHVCITDTNLYFQPLNGYPKPVVQITLQDV
RRIYKRRHGLMPLGLEVFCTEDDLCSDIYLKFYEPQDRDDLYFYIATYLEHHVAEHTAES
YMLQWQRGHLSNYQYLLHLNNLADRSCNDLSQYPVFPWIIHDYSSSELDLSNPGTFRDLS
KPVGALNKERLERLLTRYQEMPEPKFMYGSHYSSPGYVLFYLVRIAPEYMLCLQNGRFDN
ADRMFNSIAETWKNCLDGATDFKELIPEFYGDDVSFLVNSLKLDLGKRQGGQMVDDVELP
PWASSPEDFLQKSKDALESNYVSEHLHEWIDLIFGYKQKGSDAVGAHNVFHPLTYEGGVD
LNSIQDPDEKVAMLTQILEFGQTPKQLFVTPHPRRITPKFKSLSQTSSYNASMADSPGEE
SFEDLTEESKTLAWNNITKLQLHEHYKIHKEAVTGITVSRNGSSVFTTSQDSTLKMFSKE
SKMLQRSISFSNMALSSCLLLPGDATVITSSWDNNVYFYSIAFGRRQDTLMGHDDAVSKI
CWHDNRLYSASWDSTVKVWSGVPAEMPGTKRHHFDLLAELEHDVSVDTISLNAASTLLVS
GTKEGTVNIWDLTTATLMHQIPCHSGIVCDTAFSPDSRHVLSTGTDGCLNVIDVQTGMLI
SSMTSDEPQRCFVWDGNSVLSGSQSGELLVWDLLGAKISERIQGHTGAVTCIWMNEQCSS
IITGGEDRQIIFWKLQY
GenBank ID Protein 26996553
UniProtKB/Swiss-Prot ID Q92636
UniProtKB/Swiss-Prot Entry Name FAN_HUMAN
PDB IDs Not Available
GenBank Gene ID BC041124
GeneCard ID NSMAF
GenAtlas ID NSMAF
HGNC ID HGNC:8017
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Adam-Klages S, Adam D, Wiegmann K, Struve S, Kolanus W, Schneider-Mergener J, Kronke M: FAN, a novel WD-repeat protein, couples the p55 TNF-receptor to neutral sphingomyelinase. Cell. 1996 Sep 20;86(6):937-47. [PubMed:8808629 ]