Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10946
Secondary Accession Numbers
  • 17259
Name Phospholipase DDHD2
Synonyms
  1. DDHD domain-containing protein 2
  2. SAM, WWE and DDHD domain-containing protein 1
Gene Name DDHD2
Protein Type Enzyme
Biological Properties
General Function Involved in metal ion binding
Specific Function Phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine. May be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
Cellular Location
  1. Cytoplasm
  2. Cytoplasmic granule
Gene Properties
Chromosome Location Chromosome:8
Locus 8p11.23
SNPs DDHD2
Gene Sequence
>2136 bp
ATGTCATCAGTGCAGTCACAACAGGAGCAGTTGTCCCAGTCAGATCCATCTCCGTCACCA
AACTCATGTAGTTCCTTTGAGCTAATAGACATGGATGCTGGCAGCTTGTATGAACCAGTT
TCTCCCCATTGGTTTTATTGTAAGATAATAGATTCTAAGGAGACATGGATTCCTTTCAAC
TCTGAGGATTCACAGCAGCTGGAAGAGGCATATAGCTCTGGAAAAGGTTGTAATGGGAGA
GTTGTTCCTACTGATGGGGGCAGATATGATGTTCATTTGGGGGAGAGGATGCGGTATGCT
GTATACTGGGATGAACTGGCATCGGAAGTGAGACGATGTACGTGGTTTTACAAGGGGGAC
AAAGACAATAAGTATGTTCCCTACTCGGAGAGCTTCAGCCAAGTTTTAGAGGAAACTTAC
ATGCTTGCTGTAACTTTGGATGAATGGAAAAAGAAACTGGAATCTCCCAACAGAGAAATT
ATTATTTTACACAATCCAAAGCTTATGGTGCATTACCAGCCAGTTGCAGGGTCTGATGAT
TGGGGTTCAACACCCACGGAGCAGGGTCGACCAAGAACTGTGAAGAGAGGAGTTGAGAAC
ATCTCTGTTGACATTCATTGTGGAGAACCTTTACAAATAGATCACTTGGTTTTTGTAGTC
CATGGGATTGGACCAGCTTGTGATCTCCGCTTTCGAAGCATTGTACAGTGTGTTAATGAT
TTTCGCAGTGTTTCCTTGAACTTGCTACAGACACATTTTAAGAAAGCCCAAGAAAATCAG
CAGATTGGGAGGGTAGAATTTCTTCCAGTCAACTGGCACAGTCCTTTGCATTCTACTGGT
GTGGATGTAGATCTGCAGCGAATAACCCTGCCCAGCATTAACCGCCTCAGGCACTTCACC
AATGACACAATTCTGGATGTCTTCTTCTACAATAGTCCCACCTACTGTCAGACTATTGTG
GACACAGTTGCTTCTGAAATGAACCGAATATACACACTTTTTCTACAGAGGAACCCTGAT
TTCAAAGGGGGTGTATCCATTGCTGGTCATAGTTTAGGTTCGCTTATATTGTTTGATATC
CTAACAAATCAGAAAGATTCTTTGGGGGATATTGACAGTGAAAAGGATTCGCTAAATATT
GTAATGGATCAAGGAGATACACCTACACTAGAGGAAGATTTGAAGAAACTTCAGCTCTCT
GAATTCTTTGATATCTTTGAGAAGGAGAAAGTAGATAAGGAAGCTCTGGCTTTATGTACA
GACCGAGATCTTCAGGAAATAGGAATTCCTTTAGGACCAAGAAAGAAGATATTAAACTAT
TTCAGCACCAGAAAAAACTCAATGGGTATTAAGAGACCAGCCCCGCAGCCTGCTTCAGGG
GCAAACATCCCCAAAGAATCTGAGTTCTGCAGTAGCAGTAATACTAGAAATGGTGACTAT
CTGGATGTTGGCATTGGGCAGGTGTCTGTGAAATACCCCCGGCTCATCTATAAACCAGAG
ATATTCTTTGCCTTTGGATCTCCCATTGGAATGTTCCTTACTGTCCGAGGACTAAAAAGA
ATTGATCCCAACTACAGATTTCCAACGTGCAAAGGTTTCTTCAATATTTATCACCCTTTT
GATCCTGTGGCCTATAGGATTGAACCAATGGTGGTCCCAGGAGTGGAATTTGAGCCAATG
CTGATCCCACATCATAAAGGCAGGAAGCGGATGCACTTAGAACTGAGAGAGGGCTTGACC
AGGATGAGTATGGACCTTAAGAACAACTTGCTAGGTTCGCTGCGGATGGCCTGGAAGTCT
TTTACCAGAGCTCCATACCCTGCCTTACAAGCTTCAGAAACACCAGAAGAAACTGAAGCA
GAACCTGAATCAACTTCAGAGAAGCCTAGTGATGTTAACACAGAAGAGACCTCTGTGGCA
GTTAAAGAAGAAGTCCTGCCTATCAATGTGGGGATGCTGAATGGAGGCCAACGCATTGAC
TATGTGCTACAGGAGAAGCCTATTGAAAGTTTTAATGAGTATTTATTTGCTTTACAAAGC
CATCTATGCTACTGGGAGTCTGAAGATACAGTATTGCTCGTCCTCAAAGAGATCTACCAA
ACCCAGGGTATCTTCCTTGATCAGCCTTTACAGTAA
Protein Properties
Number of Residues 711
Molecular Weight 81031.1
Theoretical pI 5.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phospholipase DDHD2
MSSVQSQQEQLSQSDPSPSPNSCSSFELIDMDAGSLYEPVSPHWFYCKIIDSKETWIPFN
SEDSQQLEEAYSSGKGCNGRVVPTDGGRYDVHLGERMRYAVYWDELASEVRRCTWFYKGD
KDNKYVPYSESFSQVLEETYMLAVTLDEWKKKLESPNREIIILHNPKLMVHYQPVAGSDD
WGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACDLRFRSIVQCVND
FRSVSLNLLQTHFKKAQENQQIGRVEFLPVNWHSPLHSTGVDVDLQRITLPSINRLRHFT
NDTILDVFFYNSPTYCQTIVDTVASEMNRIYTLFLQRNPDFKGGVSIAGHSLGSLILFDI
LTNQKDSLGDIDSEKDSLNIVMDQGDTPTLEEDLKKLQLSEFFDIFEKEKVDKEALALCT
DRDLQEIGIPLGPRKKILNYFSTRKNSMGIKRPAPQPASGANIPKESEFCSSSNTRNGDY
LDVGIGQVSVKYPRLIYKPEIFFAFGSPIGMFLTVRGLKRIDPNYRFPTCKGFFNIYHPF
DPVAYRIEPMVVPGVEFEPMLIPHHKGRKRMHLELREGLTRMSMDLKNNLLGSLRMAWKS
FTRAPYPALQASETPEETEAEPESTSEKPSDVNTEETSVAVKEEVLPINVGMLNGGQRID
YVLQEKPIESFNEYLFALQSHLCYWESEDTVLLVLKEIYQTQGIFLDQPLQ
GenBank ID Protein 256017247
UniProtKB/Swiss-Prot ID O94830
UniProtKB/Swiss-Prot Entry Name DDHD2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001164232.1
GeneCard ID DDHD2
GenAtlas ID DDHD2
HGNC ID HGNC:29106
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571 ]
  4. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]
  5. Shimoi W, Ezawa I, Nakamoto K, Uesaki S, Gabreski G, Aridor M, Yamamoto A, Nagahama M, Tagaya M, Tani K: p125 is localized in endoplasmic reticulum exit sites and involved in their organization. J Biol Chem. 2005 Mar 18;280(11):10141-8. Epub 2004 Dec 28. [PubMed:15623529 ]
  6. Nakajima K, Sonoda H, Mizoguchi T, Aoki J, Arai H, Nagahama M, Tagaya M, Tani K: A novel phospholipase A1 with sequence homology to a mammalian Sec23p-interacting protein, p125. J Biol Chem. 2002 Mar 29;277(13):11329-35. Epub 2002 Jan 11. [PubMed:11788596 ]