You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10947
Secondary Accession Numbers
  • 17260
Name PRKCA protein
Synonyms Not Available
Gene Name PRKCA
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 17q22-q23.2
SNPs PRKCA
Gene Sequence
>1143 bp
GCGAGCCAGCGGCTCCGGCTCCCGCTCCCGCTCCGCGCAGCACCAGCCCGACTCTCCCCG
GCCCCCGCCGCGCCCCCTCGCCGCGACCTCGGCCACCGGCCCGCGCCCCGCGCCCGGGGT
CGCCCCGAGCCCGCACCTCTCCCCCGCCGCCCCCGCCCACCCGGCCCTCCGCGGCCGCAG
CTCCCCGGCGGAGGCAAGAGGTGGTTGGGGGGGACCATGGCTGACGTTTTCCCGGGCAAC
GACTCCACGGCGTCTCAGGACGTGGCCAACCGCTTCGCCCGCAAAGGGGCGCTGAGGCAG
AAGAACGTGCACGAGGTGAAGGACCACAAATTCATCGCGCGCTTCTTCAAGCAGCCCACC
TTCTGCAGCCACTGCACCGACTTCATCTGGGGGTTTGGGAAACAAGGCTTCCAGTGCCAA
GTTTGCTGTTTTGTGGTCCACAAGAGGTGCCATGAATTTGTTACTTTTTCTTGTCCGGGT
GCGGATAAGGGACCCGACACTGATGACCCCAGGAGCAAGCACAAGTTCAAAATCCACACT
TACGGAAGCCCCACCTTCTGCGATCACTGTGGGTCACTGCTCTATGGACTTATCCATCAA
GGGATGAAATGTGACACCTGCGATATGAACGTTCACAAGCAATGCGTCATCAATGTCCCC
AGCCTCTGCGGAATGGATCACACTGAGAAGAGGGGGCGGATTTACCTAAAGGCTGAGGTT
GCTGATGAAAAGCTCCATGTCACAGTACGAGATGCAAAAAATCTAATCCCTATGGATCCA
AACGGGCTTTCAGATCCTTATGTGAAGCTGAAACTTATTCCTGATCCCAAGAATGAAAGC
AAGCAAAAAACCAAAACCATCCGCTCCACACTAAATCCGCAGTGGAATGAGTCCTTTACA
TTCAAATTGAAACCTTCAGACAAAGACCGACGACTGTCTGTAGAAATCTGGGACTGGGAT
CGAACAACAAGGAATGACTTCATGGGATCCCTTTCCTTTGGAGTTTCGGAGCTGATGAAG
ATGCCGGCCAGTGGATGGTACAAGTTACTTAACCAAGAAGAAGGTGAGTACTACAACGTA
CCCATTCCGGAAGGGGACGAGGAAGGAAACATGGAACTCAGGCAGAAATTCGAGTGGAGA
TGA
Protein Properties
Number of Residues 380
Molecular Weight 43185.1
Theoretical pI 9.76
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>PRKCA protein
ASQRLRLPLPLRAAPARLSPAPAAPPRRDLGHRPAPRARGRPEPAPLPRRPRPPGPPRPQ
LPGGGKRWLGGTMADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPT
FCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHT
YGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEV
ADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFT
FKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNV
PIPEGDEEGNMELRQKFEWR
GenBank ID Protein 31544941
UniProtKB/Swiss-Prot ID Q7Z727
UniProtKB/Swiss-Prot Entry Name Q7Z727_HUMAN
PDB IDs
GenBank Gene ID BC053321
GeneCard ID PRKCA
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]