You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10950
Secondary Accession Numbers
  • 17263
Name Differentially expressed in FDCP 8 homolog
Synonyms
  1. DEF-8
Gene Name DEF8
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
protein binding
Process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 16q24.3
SNPs DEF8
Gene Sequence
>1539 bp
ATGGCCATCCTGTCCCTGCGAGCCCCTGGGCCCTGGCAGGCGATGCAGGTATGGGCAGAC
AGGACGCTGTTGACTCCGCACACCGGCGTGACTTCTCAGGTTCTCGGGGTGGCAGCTGCA
GTGATGACACCGCTTCCTGGTGGTCACGCCGCGGGCAGGACGCGGGAGGCCAGGTGGGAT
GCTATGGAATATGATGAGAAGCTGGCCCGTTTCCGGCAGGCCCACCTCAACCCCTTCAAC
AAGCAGTCTGGGCCGAGACAGCATGAGCAGGGCCCTGGGGAGGAGGTCCCGGACGTCACT
CCTGAAGAGGCCCTGCCTGAGCTGCCCCCTGGGGAGCCGGAATTCCGCTGCCCTGAACGC
GTGATGGATCTCGGCCTGTCTGAGGACCACTTCTCCCGCCCTGTGGGTCTGTTCCTGGCC
TCTGACGTCCAGCAGCTGCGGCAGGCGATCGAGGAGTGCAAGCAGGTGATTCTGGAGCTG
CCCGAGCAGTCGGAGAAGCAGAAGGATGCCGTGGTGCGACTCATCCACCTCCGGCTGAAG
CTCCAGGAGCTGAAGGACCCCAATGAGGATGAGCCAAACATCCGAGTGCTCCTTGAGCAC
CGCTTTTACAAGGAGAAGAGCAAGAGCGTCAAGCAGACCTGTGACAAGTGTAACACCATC
ATCTGGGGGCTCATTCAGACCTGGTACACCTGCACAGGGTGTTATTACCGCTGTCACAGT
AAGTGCTTGAACCTCATCTCCAAGCCCTGTGTGAGCTCCAAAGTCAGCCACCAAGCTGAA
TACGAACTGAACATCTGCCCTGAGACAGGGCTGGACAGCCAGGATTACCGCTGTGCCGAG
TGCCGGGCGCCCATCTCTCTGCGGGGTGTGCCCAGTGAGGCCAGGCAGTGCGACTACACC
GGCCAGTACTACTGCAGCCACTGCCACTGGAACGACCTGGCTGTGATCCCTGCACGCGTT
GTACACAACTGGGACTTTGAGCCTCGAAAGGTTTCTCGCTGCAGCATGCGCTACCTGGCG
CTGATGGTGTCTCGGCCCGTACTCAGGCTCCGGGAGATCAACCCTCTGCTGTTCAGCTAC
GTGGAGGAGCTGGTGGAGATTCGCAAGCTGCGCCAGGACATCCTGCTCATGAAGCCGTAC
TTCATCACCTGCAGGGAGGCCATGGAGGCTCGTCTGCTGCTGCAGCTCCAGGATCGGCAG
CATTTTGTGGAGAACGACGAGATGTACTCTGTCCAGGACCTCCTGGACGTGCATGCCGGC
CGCCTGGGCTGCTCGCTCACCGAGATCCACACGCTCTTCGCCAAGCACATCAAGCTGGAC
TGCGAGCGGTGCCAGGCCAAGGGCTTCGTGTGTGAGCTCTGCAGAGAGGGCGACGTGCTG
TTCCCGTTCGACAGCCACACGTCTGTGTGCGCCGACTGCTCCGCGGTCTTCCACAGGGAC
TGCTACTACGACAACTCCACCACTTGTCCCAAGTGTGCCCGGCTCAGCCTGAGGAAGCAG
TCGCTCTTCCAGGAGCCAGGTCCCGATGTGGAGGCCTAG
Protein Properties
Number of Residues 512
Molecular Weight 58709.7
Theoretical pI 6.5
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Differentially expressed in FDCP 8 homolog
MAILSLRAPGPWQAMQVWADRTLLTPHTGVTSQVLGVAAAVMTPLPGGHAAGRTREARWD
AMEYDEKLARFRQAHLNPFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPER
VMDLGLSEDHFSRPVGLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLK
LQELKDPNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCYYRCHS
KCLNLISKPCVSSKVSHQAEYELNICPETGLDSQDYRCAECRAPISLRGVPSEARQCDYT
GQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFSY
VEELVEIRKLRQDILLMKPYFITCREAMEARLLLQLQDRQHFVENDEMYSVQDLLDVHAG
RLGCSLTEIHTLFAKHIKLDCERCQAKGFVCELCREGDVLFPFDSHTSVCADCSAVFHRD
CYYDNSTTCPKCARLSLRKQSLFQEPGPDVEA
GenBank ID Protein 46447820
UniProtKB/Swiss-Prot ID Q6ZN54
UniProtKB/Swiss-Prot Entry Name DEFI8_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_207514.1
GeneCard ID DEF8
GenAtlas ID DEF8
HGNC ID HGNC:25969
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]