You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10951
Secondary Accession Numbers
  • 17264
Name Rho GTPase-activating protein 29
Synonyms
  1. PTPL1-associated RhoGAP protein 1
  2. Rho-type GTPase-activating protein 29
Gene Name ARHGAP29
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Has strong activity toward RHOA, and weaker activity toward RAC1 and CDC42. May act as a specific effector of RAP2A to regulate Rho
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signaling pathway
signaling
signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1p22.1
SNPs ARHGAP29
Gene Sequence
>3786 bp
ATGATTGCTCACAAACAGAAAAAGACAAAGAAAAAACGTGCTTGGGCATCAGGTCAACTC
TCTACTGATATTACAACTTCTGAAATGGGGCTCAAGTCCTTAAGTTCCAACTCTATTTTT
GATCCGGATTACATCAAGGAGTTGGTGAATGATATCAGGAAGTTCTCCCACATGTTACTA
TATTTGAAAGAAGCCATATTTTCAGACTGTTTTAAAGAAGTTATTCATATACGTCTAGAG
GAACTGCTCCGTGTTTTAAAGTCTATAATGAATAAACATCAGAACCTCAATTCTGTTGAT
CTTCAAAATGCTGCAGAAATGCTCACTGCAAAAGTGAAAGCTGTGAACTTCACAGAAGTT
AATGAAGAAAACAAAAACGATCTCTTCCAGGAAGTGTTTTCTTCTATTGAAACTTTGGCA
TTTACCTTTGGAAATATCCTTACAAACTTCCTTATGGGAGATGTAGGCAATGATTCATTA
TTGCGACTGCCTGTTTCTCGAGAAACTAAGTCGTTTGAAAATGTTTCTGTGGAATCAGTG
GACTCATCCAGTGAAAAAGGAAATTTTTCCCCTTTAGAACTAGACAACGTGCTGTTAAAG
AACACTGACTCTATCGAGCTGGCTTTGTCATATGCTAAAACTTGGTCAAAATATACTAAG
AACATAGTTTCATGGGTTGAAAAAAAGCTTAACTTGGAATTGGAGTCCACTAGAAATATG
GTCAAGTTGGCAGAGGCAACTAGAACTAACATTGGAATTCAGGAGTTCATGCCACTGCAG
TCTCTGTTTACTAATGCTCTTCTTAATGATATAGAAAGCAGTCACCTTTTACAACAAACA
ATTGCAGCTCTCCAGGCTAACAAATTTGTGCAGCCTCTACTTGGAAGGAAAAATGAAATG
GAAAAACAAAGGAAAGAAATAAAAGAGCTTTGGAAACAGGAGCAAAATAAAATGCTTGAA
GCAGAGAATGCTCTCAAAAAGGCAAAATTATTATGCATGCAACGTCAAGATGAATATGAG
AAAGCAAAGTCTTCCATGTTTCGTGCAGAAGAGGAGCATCTGTCTTCAAGTGGCGGATTA
GCAAAAAATCTCAACAAGCAACTAGAAAAAAAGCGAAGGTTGGAAGAGGAGGCTCTCCAA
AAAGTAGAAGAAGCAAATGAACTTTACAAAGTTTGTGTGACAAATGTTGAAGAAAGAAGA
AATGATCTAGAAAATACCAAAAGAGAAATTTTAGCACAACTCCGGACACTTGTTTTCCAG
TGTGATCTTACCCTTAAAGCTGTAACAGTTAACCTCTTCCACATGCAGCATCTGCAGGCT
GCTTCCCTTGCAGACAGTTTACAGTCTCTCTGTGATAGTGCCAAACTCTATGACCCAGGC
CAAGAGTACAGTGAATTTGTCAAGGCCACAAATTCAACTGAAGAAGAAAAAGTTGATGGA
AATGTAAATAAACATTTAAATAGTTCCCAACCTTCAGGATTTGGACCTGCCAACTCTTTA
GAGGATGTTGTACGCCTTCCTGACAGTTCTAATAAAATTGAAGAGGACAGATGCTCTAAC
AGTGCAGATATAACAGGTCCTTCCTTTATAAGATCATGGACATTTGGGATGTTTAGTGAT
TCTGAGAGCACTGGAGGGAGCAGCGAATCTAGATCTCTGGATTCAGAATCTATAAGTCCA
GGAGACTTTCATCGAAAACTTCCACGAACACCATCCAGTGGAACTATGTCCTCTGCAGAT
GATCTAGATGAAAGAGAGCCACCTTCCCCTTCAGAAACTGGACCCAATTCCCTTGGAACA
TTTAAGAAAACATTGATGTCAAAGGCAGCTCTCACACACAAGTTTCGCAAATTGAGATCC
CCCACGAAATGTAGGGATTGTGAAGGCATTGTAGTGTTCCAAGGTGTTGAATGTGAAGAG
TGTCTCCTTGTTTGTCATCGAAAGTGTTTGGAAAATTTAGTCATTATTTGTGGTCATCAG
AAACTTCCAGGAAAAATACACTTATTTGGAGCAGAATTCACACAAGTTGCAAAAAAGGAA
CCAGATGGTATCCCTTTTATACTCAAAATATGTGCCTCAGAGATTGAAAATAGAGCTTTG
TGTCTACAGGGAATTTATCGTGTGTGTGGAAACAAAATAAAAACTGAAAAATTGTGTCAA
GCTTTGGAAAATGGAATGCACTTGGTAGATATTTCAGAATTTAGTTCACATGATATCTGT
GACGTCTTGAAATTATACCTTCGGCAGCTCCCAGAACCATTTATTTTATTTCGATTGTAC
AAGGAATTTATAGACCTTGCAAAAGAGATCCAACATGTAAATGAAGAACAAGAGACAAAA
AAGAATAGTCTTGAAGACAAAAAATGGCCAAATATGTGTATAGAAATAAACCGAATTCTT
CTAAAAAGCAAAGACCTTCTAAGACAATTGCCAGCATCAAATTTTAACAGTCTTCATTTC
CTTATAGTACATCTAAAGCGGGTAGTAGATCATGCAGAAGAAAACAAGATGAACTCCAAA
AACTTGGGGGTGATATTTGGACCAAGTCTCATTAGGCCAAGGCCCACAACTGCTCCTATC
ACCATCTCCTCCCTTGCAGAGTATTCAAATCAAGCACGCTTGGTAGAGTTTCTCATTACT
TACTCACAGAAGATCTTCGATGGGTCCCTACAACCACAAGATGTTATGTGTAGCATAGGT
GTTGTTGATCAAGGCTGTTTTCCAAAGCCTCTGTTATCACCAGAAGAAAGAGACATTGAA
CGTTCCATGAAGTCACTATTTTTTTCTTCAAAGGAAGATATCCATACTTCAGAGAGTGAA
AGCAAAATTTTTGAACGAGCTACATCATTTGAGGAATCAGAACGCAAGCAAAATGCGTTA
GGAAAATGTGATGCATGTCTCAGTGACAAAGCACAGTTGCTTCTAGACCAAGAGGCTGAA
TCAGCATCCCAAAAGATAGAAGATGGTAAAACCCCTAAGCCACTTTCTCTGAAATCTGAT
AGGTCAACAAACAATGTGGAGAGGCATACTCCAAGGACCAAGATTAGACCTGTAAGTTTG
CCTGTAGATAGACTACTTCTTGCAAGTCCTCCTAATGAGAGAAATGGCAGAAATATGGGA
AATGTAAATTTAGACAAGTTTTGCAAGAATCCTGCCTTTGAAGGAGTTAATAGAAAAGAC
GCTGCTACTACTGTTTGTTCCAAATTTAATGGCTTTGACCAGCAAACTCTACAGAAAATT
CAGGACAAACAGTATGAACAAAACAGCCTAACTGCCAAGACTACAATGATCATGCCCAGT
GCACTCCAGGAAAAAGGAGTGACAACAAGCCTCCAGATTAGTGGGGACCATTCTATCAAT
GCCACTCAACCCAGTAAGCCATATGCAGAGCCAGTCAGGTCAGTGAGAGAGGCATCTGAG
AGACGGTCTTCAGATTCCTACCCTCTCGCTCCTGTCAGAGCACCCAGAACACTGCAGCCT
CAACATTGGACAACATTTTATAAACCACATGCTCCCATCATCAGTATCAGGGGGAATGAG
GAGAAGCCAGCTTCACCCTCAGCAGCAGTGCCTCCTGGCACAGATCACGATCCCCACGGT
CTCGTGGTGAAGTCAATGCCAGACCCAGACAAAGCATCAGCTTGTCCTGGGCAAGCAACT
GGTCAACCTAAAGAAGACTCTGAGGAGCTTGGCTTGCCTGATGTGAATCCAATGTGTCAG
AGACCAAGGCTAAAACGAATGCAACAGTTTGAAGACCTCGAAGGTGAAATTCCACAATTT
GTGTAG
Protein Properties
Number of Residues 1261
Molecular Weight 142062.2
Theoretical pI 6.72
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho GTPase-activating protein 29
MIAHKQKKTKKKRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLL
YLKEAIFSDCFKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAKVKAVNFTEV
NEENKNDLFQEVFSSIETLAFTFGNILTNFLMGDVGNDSLLRLPVSRETKSFENVSVESV
DSSSEKGNFSPLELDNVLLKNTDSIELALSYAKTWSKYTKNIVSWVEKKLNLELESTRNM
VKLAEATRTNIGIQEFMPLQSLFTNALLNDIESSHLLQQTIAALQANKFVQPLLGRKNEM
EKQRKEIKELWKQEQNKMLEAENALKKAKLLCMQRQDEYEKAKSSMFRAEEEHLSSSGGL
AKNLNKQLEKKRRLEEEALQKVEEANELYKVCVTNVEERRNDLENTKREILAQLRTLVFQ
CDLTLKAVTVNLFHMQHLQAASLADSLQSLCDSAKLYDPGQEYSEFVKATNSTEEEKVDG
NVNKHLNSSQPSGFGPANSLEDVVRLPDSSNKIEEDRCSNSADITGPSFIRSWTFGMFSD
SESTGGSSESRSLDSESISPGDFHRKLPRTPSSGTMSSADDLDEREPPSPSETGPNSLGT
FKKTLMSKAALTHKFRKLRSPTKCRDCEGIVVFQGVECEECLLVCHRKCLENLVIICGHQ
KLPGKIHLFGAEFTQVAKKEPDGIPFILKICASEIENRALCLQGIYRVCGNKIKTEKLCQ
ALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEIQHVNEEQETK
KNSLEDKKWPNMCIEINRILLKSKDLLRQLPASNFNSLHFLIVHLKRVVDHAEENKMNSK
NLGVIFGPSLIRPRPTTAPITISSLAEYSNQARLVEFLITYSQKIFDGSLQPQDVMCSIG
VVDQGCFPKPLLSPEERDIERSMKSLFFSSKEDIHTSESESKIFERATSFEESERKQNAL
GKCDACLSDKAQLLLDQEAESASQKIEDGKTPKPLSLKSDRSTNNVERHTPRTKIRPVSL
PVDRLLLASPPNERNGRNMGNVNLDKFCKNPAFEGVNRKDAATTVCSKFNGFDQQTLQKI
QDKQYEQNSLTAKTTMIMPSALQEKGVTTSLQISGDHSINATQPSKPYAEPVRSVREASE
RRSSDSYPLAPVRAPRTLQPQHWTTFYKPHAPIISIRGNEEKPASPSAAVPPGTDHDPHG
LVVKSMPDPDKASACPGQATGQPKEDSEELGLPDVNPMCQRPRLKRMQQFEDLEGEIPQF
V
GenBank ID Protein 134304853
UniProtKB/Swiss-Prot ID Q52LW3
UniProtKB/Swiss-Prot Entry Name RHG29_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004815.3
GeneCard ID ARHGAP29
GenAtlas ID ARHGAP29
HGNC ID HGNC:30207
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  7. Myagmar BE, Umikawa M, Asato T, Taira K, Oshiro M, Hino A, Takei K, Uezato H, Kariya K: PARG1, a protein-tyrosine phosphatase-associated RhoGAP, as a putative Rap2 effector. Biochem Biophys Res Commun. 2005 Apr 15;329(3):1046-52. [PubMed:15752761 ]
  8. Saras J, Franzen P, Aspenstrom P, Hellman U, Gonez LJ, Heldin CH: A novel GTPase-activating protein for Rho interacts with a PDZ domain of the protein-tyrosine phosphatase PTPL1. J Biol Chem. 1997 Sep 26;272(39):24333-8. [PubMed:9305890 ]
  9. Mariani L, Beaudry C, McDonough WS, Hoelzinger DB, Demuth T, Ross KR, Berens T, Coons SW, Watts G, Trent JM, Wei JS, Giese A, Berens ME: Glioma cell motility is associated with reduced transcription of proapoptotic and proliferation genes: a cDNA microarray analysis. J Neurooncol. 2001 Jun;53(2):161-76. [PubMed:11716068 ]
  10. Ripperger T, von Neuhoff N, Kamphues K, Emura M, Lehmann U, Tauscher M, Schraders M, Groenen P, Skawran B, Rudolph C, Callet-Bauchu E, van Krieken JH, Schlegelberger B, Steinemann D: Promoter methylation of PARG1, a novel candidate tumor suppressor gene in mantle-cell lymphomas. Haematologica. 2007 Apr;92(4):460-8. [PubMed:17488656 ]