You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10954
Secondary Accession Numbers
  • 17267
Name Guanine nucleotide exchange factor VAV2
Synonyms
  1. VAV-2
Gene Name VAV2
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Guanine nucleotide exchange factor for the Rho family of Ras-related GTPases. Plays an important role in angiogenesis. Its recruitement by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
binding
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
protein binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
intracellular signaling pathway
signaling
signaling pathway
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:9
Locus 9q34.1
SNPs VAV2
Gene Sequence
>2637 bp
ATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAAC
CACCGGGTGGTGTGGCCCTCGGCCGTGGTCTTCGACCTGGCGCAGGCGCTGCGCGACGGG
GTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATC
AACTTCCGGCCGCAGATGTCCCAGTTTCTGTGTTTGAAGAACATACGCACCTTCCTGAAA
GTCTGCCACGATAAATTTGGATTAAGGAACAGCGAGCTGTTTGACCCCTTTGACCTCTTC
GATGTGCGAGACTTTGGAAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATC
GCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGAC
GTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGAC
TGCGTCCCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTG
CAGCAGCCCATGATTAGATACATGCAGAAAATGGGCATGACTGAAGATGACAAGAGGAAC
TGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATT
GAGAAGAACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTC
TTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTG
TCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTT
CTGATCTACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTC
CTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGAT
GGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCAC
CTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAA
GAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAG
GAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTG
GAGGAATTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCAC
ACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAG
GGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGAC
CCCATGAACAACAAGGACGTCAAGAAGTCTCACGGGAAAATGTGGTCCTACGGCTTCTAC
CTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAG
AGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAAT
GCCAACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGC
AAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGG
GCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTG
GACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAAC
CCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTG
AGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGG
TATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGG
CCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGG
CAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGG
CCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATC
AAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTC
CTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGAC
ACCACACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGG
TCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTT
GCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACA
GCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGT
GACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACC
AACGGACGGATTGGCTGGTTTCCTTCAACGTACGTAGAAGAGGAGGGCATCCAGTGA
Protein Properties
Number of Residues 878
Molecular Weight 101288.2
Theoretical pI 7.08
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Guanine nucleotide exchange factor VAV2
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAV
FINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQL
LASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLK
EALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH
TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFY
LIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKAC
KMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGN
PAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISR
PPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHI
KVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSR
SPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG
DVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
GenBank ID Protein 55959224
UniProtKB/Swiss-Prot ID P52735
UniProtKB/Swiss-Prot Entry Name VAV2_HUMAN
PDB IDs Not Available
GenBank Gene ID AL357934
GeneCard ID VAV2
GenAtlas ID VAV2
HGNC ID HGNC:12658
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  6. Wolf-Yadlin A, Hautaniemi S, Lauffenburger DA, White FM: Multiple reaction monitoring for robust quantitative proteomic analysis of cellular signaling networks. Proc Natl Acad Sci U S A. 2007 Apr 3;104(14):5860-5. Epub 2007 Mar 26. [PubMed:17389395 ]
  7. Henske EP, Short MP, Jozwiak S, Bovey CM, Ramlakhan S, Haines JL, Kwiatkowski DJ: Identification of VAV2 on 9q34 and its exclusion as the tuberous sclerosis gene TSC1. Ann Hum Genet. 1995 Jan;59(Pt 1):25-37. [PubMed:7762982 ]
  8. Tamas P, Solti Z, Bauer P, Illes A, Sipeki S, Bauer A, Farago A, Downward J, Buday L: Mechanism of epidermal growth factor regulation of Vav2, a guanine nucleotide exchange factor for Rac. J Biol Chem. 2003 Feb 14;278(7):5163-71. Epub 2002 Nov 25. [PubMed:12454019 ]