You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10955
Secondary Accession Numbers
  • 17268
Name UNC13B variant protein
Synonyms Not Available
Gene Name UNC13B variant protein
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs UNC13B variant prote
Gene Sequence
>4863 bp
CGAGAGCAGTCGCGGCACCTGCTGAGAGGAAAGAGGGAGCGGTCCGGCGCGGCTGGGGCG
CGGCAGAGGCTTGCCCGATCCTCGGCCATGTCACTGCTCTGCGTGCGCGTTAAAAGGGCC
AAATTCCAGGGTTCACCAGATAAATTTAACACATATGTGACCCTGAAAGTACAGAATGTG
AAGAGCACAACTGTAGCAGTTCGTGGTGATCAGCCTTCCTGGGAACAGGATTTCATGTTT
GAGATTAGTCGCCTGGACCTGGGTCTAAGTGTGGAGGTATGGAACAAAGGACTGATCTGG
GACACCATGGTGGGGACTGTGTGGATTGCGCTGAAGACTATTCGTCAGTCGGATGAGGAA
GGGCCTGGGGAATGGTCCACATTAGAGGCAGAGACGTTAATGAAAGACGATGAGATCTGT
GGAACTAGAAACCCAACTCCTCATAAAATTTTGCTTGATACAAGATTTGAGTTGCCTTTT
GATATCCCAGAGGAGGAAGCCAGATATTGGACCTACAAATGGGAGCAAATCAATGCCTTG
GGAGCTGACAATGAGTATTCTAGTCAAGAAGAAAGCCAGAGGAAGCCATTGCCCACTGCT
GCCGCCCAGTGTTCTTTTGAAGACCCTGATAGTGCCGTCGATGACCGAGATAGTGACTAT
CGCAGTGAGACCAGCAACAGCTTCCCACCTCCTTACCATACAGCTTCCCAGCCCAACGCT
TCTGTGCACCAGTTCCCTGTGCCGGTGCGATCGCCACAGCAGCTGCTACTTCAAGGCAGT
TCCCGGGACTCTTGTAATGACTCTATGCAAAGTTATGACCTTGATTATCCAGAGCGGCGG
GCTATCAGCCCCACCAGCAGCAGTAGGTATGGCTCCTCCTGTAATGTGAGTCAAGGAAGC
TCTCAGCTAAGTGAACTAGACCAGTATCACGAACAAGATGACGACCATCGGGAGACGGAC
TCGATTCATTCTTGCCACAGCTCTCACAGCCTGTCCAGAGATGGCCAAGCAGGTTTTGGA
GAACAAGAGAAACCCTTGGAGGTGACAGGTCAAGCAGAGAAGGAGGCAGCATGTGAACCC
AAGGAGATGAAAGAAGATGCCACAACCCACCCTCCCCCAGATCTGGTGCTGCAAAAAGAC
CACTTCCTAGGTCCCCAGGAGAGTTTTCCTGAGGAGAATGCATCTTCACCATTTACCCAA
GCCAGAGCACATTGGATCCGAGCAGTTACCAAGGTTCGACTCCAGCTGCAGGAGATTCCA
GATGATGGTGACCCCTCTCTGCCTCAGTGGCTCCCGGAAGGGCCAGCCGGAGGGCTCTAT
GGCATTGACAGCATGCCAGATTTACGCAGAAAGAAGCCACTGCCACTTGTCAGTGATCTG
TCACTGGTCCAGTCTCGGAAGGCAGGAATCACTTCTGCAATGGCTACACGCACTTCTCTT
AAGGACGAAGAGCTGAAATCCCACGTGTATAAGAAAACCCTGCAGGCCTTAATCTACCCC
ATTTCGTGCACCACTCCTCATAACTTTGAGGTCTGGACGGCCACTACCCCAACCTACTGC
TATGAGTGTGAAGGCCTGCTCTGGGGCATTGCCCGGCAGGGCATGCGCTGCAGCGAATGT
GGAGTCAAGTGCCATGAGAAGTGCCAGGATCTGCTCAATGCTGACTGCCTGCAGCGGGCT
GCAGAAAAGAGCTGTAAACATGGAGCTGAGGACCGGACCCAGAACATTATCATGGCCATG
AAGGACCGCATGAAGATCCGAGAGCGAAATAAGCCAGAGATCTTTGAAGTTATCCGGGAC
GTCTTCACAGTGAACAAAGCTGCCCATGTGCAGCAGATGAAAACAGTGAAGCAGAGTGTA
CTGGATGGCACCTCCAAATGGTCAGCCAAGATCACCATTACTGTGGTGTGTGCCCAGGGC
CTACAAGCCAAGGACAAAACAGGATCCAGTGACCCTTACGTGACTGTGCAAGTCAGCAAA
ACTAAGAAGCGTACCAAGACCATTTTTGGAAACTTGAATCCTGTTTGGGAGGAGAAGTTC
CATTTTGAGTGCCACAACTCCTCTGACCGCATTAAGGTGCGTGTATGGGATGAGGATGAT
GACATCAAGTCAAGAGTAAAGCAACGCCTAAAGCGAGAGTCTGATGATTTCCTTGGCCAA
ACCATCATTGAGGTTCGGACCCTAAGTGGCGAGATGGACGTCTGGTACAACTTGGAGAAG
AGGACAGACAAATCAGCCGTCTCAGGGGCTATCCGACTACAAATCAGTGTGGAGATCAAG
GGGGAGGAGAAAGTAGCCCCATACCACGTGCAGTATACATGTCTCCATGAGAATCTTTTC
CATTACCTCACAGACATTCAGGGCAGTGGAGGAGTCCGCATCCCTGAAGCTCGAGGAGAC
GATGCCTGGAAGGTGTACTTTGATGAGACAGCCCAAGAAATTGTGGATGAATTTGCCATG
CGTTATGGCATTGAGTCCATATATCAGGCCATGACGCACTTTGCATGTTTATCATCCAAG
TACATGTGTCCTGGTGTGCCAGCAGTGATGAGCACCTTACTGGCCAACATCAACGCCTAC
TATGCCCACACAACTGCCTCTACCAATGTCTCTGCATCTGATCGCTTTGCAGCCTCCAAC
TTTGGGAAAGAGAGATTTGTAAAACTGCTGGACCAGCTACACAACTCACTGAGGATCGAC
CTCTCTACATACAGGAATAATTTCCCTGCTGGGAGTCCTGAACGGCTTCAGGACTTAAAA
TCCACAGTGGATTTGCTGACCAGCATTACTTTCTTCAGAATGAAGGTACAAGAACTGCAA
AGCCCTCCAAGAGCCAGCCAGGTGGTAAAGGATTGTGTGAAGGCCTGTTTGAACTCCACA
TATGAATATATCTTCAACAACTGCCACGACTTATACAGCCGCCAGTACCAGCTGAAGCAG
GAGCTACCTCCAGAGGAACAAGGGCCCAGCATTCGGAACCTGGATTTCTGGCCCAAGCTC
ATCACACTCATCGTGTCAATCATAGAGGAAGATAAGAATTCCTACACACCTGTTCTGAAC
CAGTTTCCTCAGGAGTTGAATGTGGGAAAAGTCAGCGCAGAAGTGATGTGGCATTTGTTT
GCCCAAGACATGAAATATGCATTGGAGGAGCATGAGAAAGACCACCTGTGTAAAAGTGCT
GACTACATGAACCTGCACTTCAAGGTGAAGTGGCTCCACAATGAATACGTGCGGGATCTG
CCTGTCCTCCAGGGGCAGGTGCCTGAGTACCCAGCGTGGTTTGAGCAGTTCGTGCTACAA
TGGCTGGATGAGAATGAGGATGTATCCCTGGAATTCCTGCGTGGGGCCCTGGAACGAGAT
AAGAAGGATGGATTCCAGCAGACATCAGAGCATGCACTCTTTTCCTGCTCTGTGGTGGAT
GTCTTCACACAACTCAATCAGAGCTTTGAGATCATCCGGAAGCTGGAATGCCCAGACCCC
AGCATCCTTGCCCACTACATGAGGAGGTTTGCTAAGACCATCGGGAAGGTGCTGATGCAG
TATGCAGACATCTTGTCAAAGGACTTCCCAGCCTATTGCACAAAGGAGAAACTGCCCTGC
ATCCTGATGAACAACGTGCAGCAACTGAGGGTCCAGCTGGAGAAAATGTTTGAGGCCATG
GGAGGCAAGGAGCTGGACCTTGAAGCTGCAGACAGTCTGAAGGAGCTGCAGGTGAAACTG
AATACGGTTCTGGATGAGCTCAGCATGGTGTTTGGAAACAGTTTCCAGGTACGGATTGAT
GAGTGTGTTCGACAAATGGCCGACATCCTGGGCCAGGTTCGGGGCACAGGGAATGCATCT
CCAGACGCCAGGGCCTCAGCGGCTCAGGATGCAGATAGCGTACTCCGGCCTCTCATGGAC
TTCCTGGATGGCAACCTCACCCTCTTTGCCACTGTGTGTGAGAAGACGGTTCTGAAGCGT
GTACTGAAGGAGCTCTGGCGCGTGGTGATGAACACAATGGAGAGGATGATTGTTCTGCCC
CCACTCACTGACCAGACGGGCACCCAGCTGATCTTCACTGCTGCCAAGGAGCTGAGCCAT
CTTTCCAAACTCAAGGATCACATGGTACGAGAGGAAACACGGAATCTCACTCCAAAGCAG
TGTGCAGTCCTTGACCTCGCCCTGGACACCATCAAGCAATACTTCCATGCAGGAGGCAAT
GGGCTGAAGAAAACCTTCCTGGAGAAGAGCCCAGATCTGCAGTCTCTACGCTATGCCCTG
TCTCTGTACACACAGACTACTGACACTCTCATCAAGACCTTTGTGCGCTCGCAGACCACC
CAAGGGTCTGGTGTGGACGATCCTGTGGGAGAAGTCTCTATTCAGGTGGACTTGTTTACA
CACCCTGGTACTGGGGAGCACAAGGTCACAGTGAAAGTGGTGGCTGCCAATGACCTCAAG
TGGCAGACAGCGGGTATGTTCCGGCCTTTCGTGGAGGTGACTATGGTTGGCCCACACCAA
AGTGATAAGAAGAGGAAGTTCACAACCAAATCCAAAAGCAACAACTGGGCCCCCAAGTAC
AATGAGACATTCCACTTCCTCCTGGGAAATGAGGAGGGGCCCGAGTCCTATGAGTTGCAG
ATATGCGTGAAGGATTACTACTTTGCCCGGGAAGATCGCGTGCTAGGGCTGGCTGTGATG
CCTCTGAGGGATGTCACAGCCAAGGGCAGCTGTGCCTGCTGGTGCCCCTTGGGCCGGAAG
ATCCATATGGATGAGACAGGCCTGACCATTCTCCGGATTTTATCTCAGAGGAGCAATGAC
GAGGTGGCCCGAGAATTTGTGAAACTCAAATCAGAGTCTCGTTCCACGGAGGAGGGGAGC
TGA
Protein Properties
Number of Residues 1620
Molecular Weight 183980.9
Theoretical pI 6.18
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>UNC13B variant protein
REQSRHLLRGKRERSGAAGARQRLARSSAMSLLCVRVKRAKFQGSPDKFNTYVTLKVQNV
KSTTVAVRGDQPSWEQDFMFEISRLDLGLSVEVWNKGLIWDTMVGTVWIALKTIRQSDEE
GPGEWSTLEAETLMKDDEICGTRNPTPHKILLDTRFELPFDIPEEEARYWTYKWEQINAL
GADNEYSSQEESQRKPLPTAAAQCSFEDPDSAVDDRDSDYRSETSNSFPPPYHTASQPNA
SVHQFPVPVRSPQQLLLQGSSRDSCNDSMQSYDLDYPERRAISPTSSSRYGSSCNVSQGS
SQLSELDQYHEQDDDHRETDSIHSCHSSHSLSRDGQAGFGEQEKPLEVTGQAEKEAACEP
KEMKEDATTHPPPDLVLQKDHFLGPQESFPEENASSPFTQARAHWIRAVTKVRLQLQEIP
DDGDPSLPQWLPEGPAGGLYGIDSMPDLRRKKPLPLVSDLSLVQSRKAGITSAMATRTSL
KDEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSEC
GVKCHEKCQDLLNADCLQRAAEKSCKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRD
VFTVNKAAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVSK
TKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQ
TIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLF
HYLTDIQGSGGVRIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSK
YMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRID
LSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNST
YEYIFNNCHDLYSRQYQLKQELPPEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLN
QFPQELNVGKVSAEVMWHLFAQDMKYALEEHEKDHLCKSADYMNLHFKVKWLHNEYVRDL
PVLQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVD
VFTQLNQSFEIIRKLECPDPSILAHYMRRFAKTIGKVLMQYADILSKDFPAYCTKEKLPC
ILMNNVQQLRVQLEKMFEAMGGKELDLEAADSLKELQVKLNTVLDELSMVFGNSFQVRID
ECVRQMADILGQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKR
VLKELWRVVMNTMERMIVLPPLTDQTGTQLIFTAAKELSHLSKLKDHMVREETRNLTPKQ
CAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTT
QGSGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQ
SDKKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPESYELQICVKDYYFAREDRVLGLAVM
PLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQRSNDEVAREFVKLKSESRSTEEGS
GenBank ID Protein 68533051
UniProtKB/Swiss-Prot ID Q4LE73
UniProtKB/Swiss-Prot Entry Name Q4LE73_HUMAN
PDB IDs
GenBank Gene ID AB209998
GeneCard ID UNC13B variant prote
GenAtlas ID UNC13B+variant+prote
HGNC ID HGNC:12566
References
General References Not Available