You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10956
Secondary Accession Numbers
  • 17269
Name Rho-guanine nucleotide exchange factor
Synonyms
  1. 190 kDa guanine nucleotide exchange factor
  2. p190-RhoGEF
  3. p190RhoGEF
Gene Name RGNEF
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Functions as a RHOA-specific guanine nucleotide exchange factor regulating signaling pathways downstream of integrins and growth factor receptors. Functions in axonal branching, synapse formation and dendritic morphogenesis. Functions also in focal adhesion formation, cell motility and B-lymphocytes activation. May regulate NEFL expression and aggregation and play a role in apoptosis
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
intracellular signaling pathway
signaling
signaling pathway
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cell membrane
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:5
Locus 5q13.2
SNPs RGNEF
Gene Sequence
>5118 bp
ATGGAGTTGAGCTGCAGCGAAGCACCTCTTTACGGGCAGATGATGATCTATGCGAAGTTT
GACAAAAATGTGTATCTTCCTGAAGATGCTGAGTTTTACTTTACTTATGACGGATCTCAT
CAGCGACATGTCATGATTGCAGAGCGCATCGAGGATAACGTTCTCCAGTCCAGCGTCCCA
GGCCATGGGCTTCAGGAGACGGTGACGGTATCTGTGTGCCTCTGCTCGGAAGGTTACTCT
CCGGTGACCATGGGCTCTGGCTCAGTGACCTACGTGGACAACATGGCTTGCAGGCTGGCT
CGTCTGCTGGTGACGCAGGCCAATCGCCTCACAGCCTGCAGCCACCAGACCCTGCTGACC
CCATTTGCCTTGACGGCAGGAGCACTGCCTGCCTTGGATGAGGAGCTCGTGCTGGCTCTG
ACCCATCTGGAATTGCCTCTAGAGTGGACTGTGTTGGGAAGTTCTTCACTTGAAGTATCT
TCTCACAGAGAATCTCTTCTACACCTGGCTATGAGATGGGGCCTGGCTAAACTTTCCCAG
TTCTTCTTGTGTCTCCCGGGGGGAGTCCAGGCCTTGGCTTTACCCAACGAAGAGGGTGCC
ACACCATTAGACTTAGCTTTACGTGAAGGACACTCCAAGCTGGTGGAAGACGTCACAAAT
TTTCAGGGCAGATGGTCCCCAAGCTTCTCCCGAGTGCAGCTCAGTGAAGAAGCCTCCTTG
CATTACATTCACTCATCGGAAACGCTGACCCTGACCCTGAACCACACAGCCGAGCATTTG
TTGGAGGCAGATATTAAACTCTTCCGGAAATACTTTTGGGATAGAGCCTTTCTTGTCAAG
GCCTTTGAGCCAGAAGCCAGGCCAGAGGAAAGAACAGCTATGCCCTCCAGCGGTGCAGAA
ACTGAAGAAGAGATTAAGAATTCAGTGTCCAGCAGATCAGCAGCTGAAAAGGAAGATATA
AAGCGTGTCAAAAGCCTGGTGGTTCAACACAATGAACATGAAGACCAGCACAGCCTAGAT
TTGGATCGCTCCTTCGATATCCTAAAAAAATCCAAGCCGCCCTCGACATTGCTTGCTGCA
GGCCGGCTTTCAGACATGCTGAATGGAGGTGATGAAGTCTACGCTAACTGTATGGTGATT
GATCAGGTTGGTGATTTGGATATCAGCTATATTAATATAGAGGGAATCACTGCCACTACC
AGCCCTGAATCCAGAGGTTGCACTCTGTGGCCTCAGAGCAGCAAACACACCCTTCCTACA
GAAACCAGTCCCAGTGTGTACCCACTTAGTGAAAATGTCGAAGGGACAGCACACACTGAA
GCCCAGCAGTCCTTCATGTCACCATCAAGTTCGTGTGCTTCCAACTTGAATCTTTCTTTT
GGTTGGCATGGATTTGAAAAGGAACAAAGTCATCTAAAGAAAAGAAGTTCTAGCCTTGAT
GCCTTGGACGCCGACAGTGAAGGGGAAGGGCATTCTGAGCCATCCCACATCTGTTACACT
CCAGGGTCTCAGAGCTCCTCAAGAACTGGGATTCCTAGTGGGGATGAATTGGACTCTTTT
GAGACTAACACTGAACCGGATTTTAATATCTCCAGGGCTGAATCCCTTCCTCTATCAAGT
AATCTACAGTCGAAGGAATCACTGCTTTCTGGAGTTCGCTCACGTTCTTATTCTTGCTCA
TCACCCAAAATTTCTTTAGGAAAAACTCGTTTGGTGCGTGAATTAACAGTATGCAGTTCA
AGTGAAGAGCAAAGAGCTTACAGCTTATCGGAGCCACCAAGAGAAAACAGAATTCAGGAA
GAAGAATGGGATAAATACATCATACCTGCCAAATCAGAGTCTGAAAAATATAAAGTGAGT
CGAACTTTCAGTTTCCTCATGAATAGGATGACTAGCCCTCGGAATAAATCAAAGACAAAA
AGCAAGGATGCCAAAGATAAAGAGAAGCTGAATCGACATCAGTTTGCCCCAGGAACATTC
TCTGGGGTTCTGCAGTGTTTGGTTTGTGATAAAACACTCCTGGGGAAAGAGTCACTGCAG
TGTTCTAACTGTAATGCAAATGTGCACAAAGGTTGTAAAGATGCTGCGCCTGCATGCACC
AAGAAATTCCAAGAGAAATATAACAAGAACAAACCACAGACCATCCTTGGAAATTCTTCA
TTTAGAGACATCCCACAGCCTGGTCTCTCCTTGCACCCTTCTTCCTCCGTGCCTGTTGGA
TTGCCGACTGGAAGGAGGGAGACTGTGGGACAGGTCCATCCATTGTCCAGAAGTGTTCCA
GGCACCACCTTGGAAAGCTTCAGGAGGTCAGCCACATCCTTGGAGTCTGAGAGTGACCAT
AACAGCTGCAGAAGCAGGTCTCATTCTGATGAGCTGCTACAGTCCATGGGCTCTTCTCCC
TCTACAGAGTCTTTCATAATGGAAGATGTTGTGGATTCTTCTCTGTGGAGTGACCTCAGC
AGTGATGCCCAGGAGTTTGAAGCAGAATCTTGGAGTCTTGTGGTGGATCCCTCATTTTGT
AATAGGCAGGAGAAGGATGTCATCAAAAGACAGGATGTCATTTTTGAGCTAATGCAAACA
GAGATGCATCACATCCAGACCCTGTTCATCATGTCTGAGATCTTCAGGAAAGGCATGAAA
GAGGAGCTGCAGCTGGACCACAGCACCGTGGATAAAATTTTCCCCTGTTTAGATGAGTTG
CTTGAAATCCACAGGCATTTCTTCTACAGTATGAAGGAACGAAGGCAGGAATCCTGTGCT
GGCAGCGACAGGAATTTTGTGATCGACCGAATTGGAGATATTTTGGTACAACAGTTTTCA
GAAGAAAATGCAAGTAAAATGAAGAAAATATATGGAGAATTCTGTTGCCATCATAAAGAA
GCTGTTAACCTCTTTAAAGAACTCCAGCAGAATAAAAAGTTTCAGAATTTTATTAAGCTC
CGAAATAGTAATCTTTTGGCTCGACGCCGAGGAATTCCAGAATGCATTCTGTTGGTCACT
CAGCGTATTACAAAATACCCTGTCTTGGTGGAAAGGATATTGCAGTACACAAAGGAAAGA
ACTGAGGAACATAAAGACTTACGCAAAGCGCTTTGCTTAATTAAAGACATGATTGCAACA
GTGGATTTAAAAGTCAATGAATATGAGAAAAACCAAAAATGGCTTGAGATCCTAAATAAG
ATTGAAAACAAAACATACACGAAGCTCAAAAATGGACATGTGTTTAGGAAGCAGGCACTG
ATGAGTGAAGAAAGGACTCTGTTATATGATGGCCTTGTTTACTGGAAAACTGCTACAGGT
CGTTTCAAAGATATCCTAGCTCTACTTCTAACTGATGTGCTGCTCTTTTTACAAGAAAAA
GACCAGAAATACATCTTTGCAGCCGTTGATCAGAAGCCATCAGTTATTTCCCTTCAAAAG
CTTATTGCTAGAGAAGTTGCTAATGAGGAGAGAGGAATGTTTCTGATCAGTGCTTCATCT
GCTGGTCCTGAGATGTATGAAATTCACACCAATTCCAAGGAGGAACGCAATAACTGGATG
AGACGGATCCAGCAGGCTGTAGAAAGTTGTCCTGAAGAAAAAGGGGGAAGGACAAGTGAA
TCTGATGAAGACAAGAGGAAAGCTGAAGCCAGAGTGGCCAAAATTCAGCAATGTCAAGAA
ATACTCACTAACCAAGACCAACAAATTTGTGCGTATTTGGAGGAGAAGCTGCATATCTAT
GCTGAACTTGGAGAACTGAGCGGATTTGAGGACGTCCATCTAGAGCCCCACCTCCTTATT
AAACCTGACCCAGGCGAGCCTCCCCAGGCAGCCTCATTACTGGCAGCAGCACTGAAAGAA
GCTGAGAGCCTACAAGTTGCAGTGAAGGCCTCACAGATGGGCGCCGTGAGTCAATCATGT
GAGGACAGTTGTGGAGACTCTGTCTTGGCGGACACACTCAGTTCTCATGATGTACCAGGA
TCACCGACTGCCTCATTAGTCACAGGAGGGAGAGAAGGAAGAGGCTGTTCGGATGTGGAT
CCCGGGATCCAGGGTGTGGTAACCGACTTGGCCGTCTCTGATGCAGGGGAGAAGGTGGAA
TGTAGAAATTTTCCAGGTTCTTCACAATCAGAGATTATACAAGCCATACAGAATTTAACC
CGTCTCTTATACAGCCTTCAGGCCGCCTTGACCATTCAGGACAGCCACATTGAGATCCAC
AGGCTGGTTCTCCAGCAGCAGGAGGGCCTGTCTCTCGGCCACTCTATCCTCCGAGGCGGC
CCCTTGCAGGACCAGAAGTCTCGCGACGCGGACAGGCAGCATGAGGAGCTGGCCAATGTG
CACCAGCTTCAGCACCAGCTCCAGCAGGAGCAGCGGCGCTGGCTGCGCAGGTGTGAGCAG
CAGCAGCGGGCGCAGGCGACCAGGGAGAGCTGGCTGCAGGAGCGGGAGCGGGAGTGCCAG
TCGCAGGAGGAGCTGCTGCTGCGGAGCCGGGGCGAGCTGGACCTCCAGCTCCAGGAGTAC
CAGCACAGCCTGGAGCGGCTGAGGGAGGGCCAGCGCCTGGTGGAGAGGGAGCAGGCGAGG
ATGCGGGCCCAGCAGAGCCTGCTGGGCCACTGGAAGCACGGCCGGCAGAGGAGCCTGCCC
GCGGTGCTCCTTCCGGGTGGCCCCGAGGTAATGGAACTTAATCGATCTGAGAGTTTATGT
CATGAAAACTCATTCTTCATCAATGAAGCTTTAGTACAAATGTCATTTAACACTTTCAAC
AAACTGAATCCATCAGTTATCCATCAGGATGCCACTTACCCTACAACTCAATCTCATTCT
GACTTGGTGAGGACTAGTGAACATCAAGTAGACCTCAAGGTGGACCCTTCTCAGCCTTCG
AATGTCAGTCACAAACTGTGGACAGCCGCTGGTTCCGGCCATCAGATACTTCCTTTCCAT
GAAAGCAGCAAGGATTCTTGTAAAAATGATTTGGACACCTCCCACACTGAGTCCCCAACC
CCCCATGACTCAAATTCACACCGCCCTCAACTGCAGGCGTTTATAACAGAAGCAAAGCTA
AATCTACCGACAAGGACAATGACCAGACAAGATGGGGAAACTGGAGATGGAGCCAAAGAA
AATATTGTTTACCTCTAA
Protein Properties
Number of Residues 1705
Molecular Weight 191889.8
Theoretical pI 5.91
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho-guanine nucleotide exchange factor
MELSCSEAPLYGQMMIYAKFDKNVYLPEDAEFYFTYDGSHQRHVMIAERIEDNVLQSSVP
GHGLQETVTVSVCLCSEGYSPVTMGSGSVTYVDNMACRLARLLVTQANRLTACSHQTLLT
PFALTAGALPALDEELVLALTHLELPLEWTVLGSSSLEVSSHRESLLHLAMRWGLAKLSQ
FFLCLPGGVQALALPNEEGATPLDLALREGHSKLVEDVTNFQGRWSPSFSRVQLSEEASL
HYIHSSETLTLTLNHTAEHLLEADIKLFRKYFWDRAFLVKAFEPEARPEERTAMPSSGAE
TEEEIKNSVSSRSAAEKEDIKRVKSLVVQHNEHEDQHSLDLDRSFDILKKSKPPSTLLAA
GRLSDMLNGGDEVYANCMVIDQVGDLDISYINIEGITATTSPESRGCTLWPQSSKHTLPT
ETSPSVYPLSENVEGTAHTEAQQSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLD
ALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNISRAESLPLSS
NLQSKESLLSGVRSRSYSCSSPKISLGKTRLVRELTVCSSSEEQRAYSLSEPPRENRIQE
EEWDKYIIPAKSESEKYKVSRTFSFLMNRMTSPRNKSKTKSKDAKDKEKLNRHQFAPGTF
SGVLQCLVCDKTLLGKESLQCSDCNANVHKGCKDAAPACTKKFQEKYNKNKPQTILGNSS
FRDIPQPGLSLHPSSSVPVGLPTGRRETVGQVHPLSRSVPGTTLESFRRSATSLESESDH
NSCRSRSHSDELLQSMGSSPSTESFIMEDVVDSSLWSDLSSDAQEFEAESWSLVVDPSFC
NRQEKDVIKRQDVIFELMQTEMHHIQTLFIMSEIFRKGMKEELQLDHSTVDKIFPCLDEL
LEIHRHFFYSMKERRQESCAGSDRNFVIDRIGDILVQQFSEENASKMKKIYGEFCCHHKE
AVNLFKELQQNKKFQNFIKLRNSNLLARRRGIPECILLVTQRITKYPVLVERILQYTKER
TEEHKDLRKALCLIKDMIATVDLKVNEYEKNQKWLEILNKIENKTYTKLKNGHVFRKQAL
MSEERTLLYDGLVYWKTATGRFKDILALLLTDVLLFLQEKDQKYIFAAVDQKPSVISLQK
LIAREVANEERGMFLISASSAGPEMYEIHTNSKEERNNWMRRIQQAVESCPEEKGGRTSE
SDEDKRKAEARVAKIQQCQEILTNQDQQICAYLEEKLHIYAELGELSGFEDVHLEPHLLI
KPDPGEPPQAASLLAAALKEAESLQVAVKASQMGAVSQSCEDSCGDSVLADTLSSHDVPG
SPTASLVTGGREGRGCSDVDPGIQGVVTDLAVSDAGEKVECRNFPGSSQSEIIQAIQNLT
RLLYSLQAALTIQDSHIEIHRLVLQQQEGLSLGHSILRGGPLQDQKSRDADRQHEELANV
HQLQHQLQQEQRRWLRRCEQQQRAQATRESWLQERERECQSQEELLLRSRGELDLQLQEY
QHSLERLREGQRLVEREQARMRAQQSLLGHWKHGRQRSLPAVLLPGGPEVMELNRSESLC
HENSFFINEALVQMSFNTFNKLNPSVIHQDATYPTTQSHSDLVRTSEHQVDLKVDPSQPS
NVSHKLWTAAGSGHQILPFHESSKDSCKNDLDTSHTESPTPHDSNSHRPQLQAFITEAKL
NLPTRTMTRQDGETGDGAKENIVYL
GenBank ID Protein 295148070
UniProtKB/Swiss-Prot ID Q8N1W1
UniProtKB/Swiss-Prot Entry Name RGNEF_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001177693.1
GeneCard ID RGNEF
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  5. Ohara O, Nagase T, Mitsui G, Kohga H, Kikuno R, Hiraoka S, Takahashi Y, Kitajima S, Saga Y, Koseki H: Characterization of size-fractionated cDNA libraries generated by the in vitro recombination-assisted method. DNA Res. 2002 Apr 30;9(2):47-57. [PubMed:12056414 ]
  6. Meyer D, Liu A, Margolis B: Interaction of c-Jun amino-terminal kinase interacting protein-1 with p190 rhoGEF and its localization in differentiated neurons. J Biol Chem. 1999 Dec 3;274(49):35113-8. [PubMed:10574993 ]
  7. Kim H, Han JR, Park J, Oh M, James SE, Chang S, Lu Q, Lee KY, Ki H, Song WJ, Kim K: Delta-catenin-induced dendritic morphogenesis. An essential role of p190RhoGEF interaction through Akt1-mediated phosphorylation. J Biol Chem. 2008 Jan 11;283(2):977-87. Epub 2007 Nov 8. [PubMed:17993462 ]