You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10960
Secondary Accession Numbers
  • 17274
Name Gamma-1-syntrophin
Synonyms
  1. G1SYN
  2. SYN4
  3. Syntrophin-4
Gene Name SNTG1
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Adapter protein that binds to and probably organizes the subcellular localization of a variety of proteins. May link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex. May participate in regulating the subcellular location of diacylglycerol kinase-zeta to ensure that diacylglycerol is rapidly inactivated following receptor activation
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. cytoskeleton
Gene Properties
Chromosome Location Chromosome:8
Locus 8q11-q12
SNPs SNTG1
Gene Sequence
>1554 bp
ATGGATTTCAGAACCGCCTGTGAGGAGACAAAGACAGGAATTTGTTTGCTGCAGGATGGT
AACCAGGAGCCTTTCAAAGTGCGGCTGCACCTAGCCAAAGACATTTTGATGATCCAGGAA
CAGGATGTGATATGTGTGTCTGGTGAGCCTTTCTATTCTGGTGAAAGAACGGTGACCATC
AGAAGACAAACAGTAGGAGGATTTGGATTAAGCATAAAGGGAGGAGCAGAACATAACATT
CCAGTTGTCGTTTCAAAAATCTCCAAGGAACAAAGAGCGGAACTTTCAGGACTACTTTTT
ATTGGAGATGCAATTCTACAGATAAATGGCATTAATGTGAGAAAATGTAGACATGAAGAA
GTGGTTCAGGTTCTTCGGAATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAA
AGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGAC
CAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCC
AACAATACAGACACATTATCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAG
AAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTG
CCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGC
ACTGGGATTATTCAGTGCCTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCA
ACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTA
AACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGAC
AGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCA
CCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATT
ATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTG
CAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAG
TGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACC
TATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTT
ATCTGCTTTGATGCTGCAACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAA
GGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAA
CAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCAT
TCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACT
GCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACAACTTGA
Protein Properties
Number of Residues 517
Molecular Weight 57968.7
Theoretical pI 6.65
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Gamma-1-syntrophin
MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTI
RRQTVGGFGLSIKGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQINGINVRKCRHEE
VVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRFSQYVPGTDLSRQNAFQVIAVDGVC
TGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQD
RVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDLLDRRKQCFTV
QSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF
ICFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIH
SFFAAKVACLDPLFLGNQATASTAASSATTSKAKYTT
GenBank ID Protein 9507163
UniProtKB/Swiss-Prot ID Q9NSN8
UniProtKB/Swiss-Prot Entry Name SNTG1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_018967.2
GeneCard ID SNTG1
GenAtlas ID SNTG1
HGNC ID HGNC:13740
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Hogan A, Shepherd L, Chabot J, Quenneville S, Prescott SM, Topham MK, Gee SH: Interaction of gamma 1-syntrophin with diacylglycerol kinase-zeta. Regulation of nuclear localization by PDZ interactions. J Biol Chem. 2001 Jul 13;276(28):26526-33. Epub 2001 May 14. [PubMed:11352924 ]
  4. Piluso G, Mirabella M, Ricci E, Belsito A, Abbondanza C, Servidei S, Puca AA, Tonali P, Puca GA, Nigro V: Gamma1- and gamma2-syntrophins, two novel dystrophin-binding proteins localized in neuronal cells. J Biol Chem. 2000 May 26;275(21):15851-60. [PubMed:10747910 ]