You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10964
Secondary Accession Numbers
  • 17278
Name Myosin-IXa
Synonyms
  1. Unconventional myosin-9a
Gene Name MYO9A
Protein Type Unknown
Biological Properties
General Function Involved in motor activity
Specific Function Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho activity in neurons, has a role in the regulation of neuronal morphology and function
Pathways Not Available
Reactions Not Available
GO Classification
Component
myosin complex
cell part
macromolecular complex
protein complex
intracellular
Function
binding
catalytic activity
hydrolase activity
motor activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Membrane
  2. Single-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 15q22-q23
SNPs MYO9A
Gene Sequence
>7647 bp
ATGAATATAAATGATGGAGGAAGACGACGCTTTGAAGATAATGAACATACATTACGGATA
TATCCTGGGGCTATTTCAGAAGGGACAATCTACTGTCCGATTCCTGCCAGAAAAAACTCC
ACAGCTGCTGAGGTGATTGAGTCTCTTATAAACAAACTTCATCTTGACAAAACAAAATGT
TATGTTCTAGCAGAGGTAAAGGAATTTGGTGGAGAAGAATGGATTCTCAATCCAACAGAT
TGTCCAGTTCAGCGAATGATGCTGTGGCCCCGAATGGCTCTGGAAAATCGCTTAAGTGGA
GAGGACTACCGCTTCCTTCTGAGAGAGAAAAACCTTGATGGATCAATCCATTATGGTAGC
CTGCAGTCATGGCTACGGGTAACAGAAGAACGTCGCAGGATGATGGAACGGGGTTTTCTT
CCACAGCCTCAACAGAAAGACTTTGATGATTTATGTAGTTTACCTGATTTGAATGAGAAA
ACTCTCTTAGAAAACCTACGAAATCGCTTTAAGCATGAAAAAATTTATACCTATGTTGGC
AGTATTCTAATAGTTATTAACCCATTCAAGTTTCTTCCTATTTATAACCCCAAATATGTC
AAAATGTATGATAACCACCAACTGGGAAAACTTGAGCCCCACATTTATGCTGTGGCTGAT
GTAGCTTATCATGCCATGCTTCAGCGCAAAAAGAATCAGTGCATCGTGATTTCAGGAGAG
AGTGGTTCTGGGAAGACTCAAAGCACAAACTTTCTTATTCACCACCTTACTGCTCTCAGT
CAGAAAGGATTTGCCAGTGGAGTAGAACAGATTATTCTTGGAGCTGGACCAGTACTTGAG
GCCTTTGGAAATGCAAAGACAGCTCATAATAACAATTCAAGTCGTTTTGGGAAGTTTATT
CAAGTAAATTACCAGGAAACAGGCACTGTACTTGGTGCCTATGTTGAAAAATATCTACTG
GAGAAGTCCAGACTCGTTTATCAGGAGCATAATGAACGGAACTATCATGTATTCTATTAC
CTCCTGGCAGGAGCAAGTGAAGATGAGAGATCAGCATTCCATCTTAAGCAACCAGAGGAA
TATCATTATCTCAATCAGATAACAAAGAAACCCCTCAGACAGAGCTGGGATGATTATTGC
TATGACTCTGAGCCGGATTGCTTCACGGTGGAAGGAGAAGATTTGAGACATGACTTTGAG
CGCCTACAACTTGCCATGGAAATGGTAGGATTTCTTCCCAAGACACGAAGACAGATTTTC
TCTCTTCTCTCAGCCATACTACATTTGGGTAATATCTGTTACAAAAAGAAGACATACCGG
GATGACTCCATTGATATCTGTAATCCTGAAGTTCTGCCTATTGTCTCAGAATTATTAGAG
GTTAAAGAAGAGATGCTATTTGAAGCATTAGTTACAAGGAAGACGGTGACAGTGGGAGAA
AAGCTTATTTTGCCATACAAGTTGGCAGAGGCTGTGACAGTGAGGAACTCCATGGCTAAG
TCTCTGTATAGTGCCCTGTTTGACTGGATAGTTTTTCGAATTAATCATGCACTTCTGAAT
AGTAAAGATTTAGAGCATAATACCAAGACATTGTCTATTGGTGTTCTTGATATTTTTGGG
TTTGAAGATTATGAAAATAACAGCTTTGAACAGTTCTGTATTAATTTTGCTAATGAACGT
TTACAGCACTACTTTAATCAGCATATCTTTAAATTGGAACAAGAGGAATATAGAACTGAA
GGTATCAGCTGGCACAACATAGATTACATTGATAATACCTGCTGCATAAATCTTATTAGC
AAAAAACCAACAGGACTGCTTCATCTTTTGGATGAAGAAAGCAACTTTCCACAGGCTACA
AATCAAACATTGCTAGACAAGTTTAAGCATCAACATGAAGATAATTCTTACATCGAATTT
CCAGCCGTGATGGAGCCTGCTTTCATTATAAAACATTATGCTGGAAAAGTAAAATATGGG
GTAAAGGATTTCCGGGAAAAAAATACAGATCATATGCGCCCAGACATTGTAGCTCTTCTG
AGAAGCAGCAAGAATGCATTTATCTCTGGGATGATTGGAATTGATCCTGTAGCTGTTTTC
CGATGGGCAATTCTCCGAGCTTTTTTCAGAGCCATGGTTGCTTTCAGGGAAGCTGGGAAA
AGAAACATTCACAGAAAAACTGGACATGATGATACAGCGCCATGTGCAATTTTGAAAAGT
ATGGATAGTTTTAGCTTTCTCCAACACCCAGTCCACCAGAGGAGCTTAGAGATTCTGCAG
AGATGCAAGGAAGAGAAGTACAGTATAACCCGGAAAAATCCCAGAACACCTCTTTCTGAT
CTCCAGGGCATGAATGCTCTAAATGAAAAAAACCAACATGATACATTTGATATTGCCTGG
AATGGCAGAACTGGGATTCGCCAGAGCAGACTATCAAGTGGCACCTCCTTGCTTGATAAA
GATGGAATATTTGCTAATTCAACTAGCAGCAAACTCCTGGAGAGAGCCCATGGAATTCTC
ACGAGAAACAAAAATTTCAAATCCAAGCCTGCCCTTCCAAAGCACTTGCTAGAAGTAAAT
TCTTTAAAGCACCTGACAAGACTGACACTACAAGATCGCATTACCAAGTCTCTTCTTCAT
TTACACAAGAAGAAAAAACCTCCCAGCATCAGTGCCCAGTTTCAGGCATCATTAAGCAAG
CTAATGGAAACACTTGGTCAAGCAGAACCATATTTTGTAAAATGCATTCGCTCTAATGCT
GAAAAGCTGCCCTTAAGGTTCAGTGATGTCTTGGTACTTAGACAGCTTCGATACACCGGG
ATGCTGGAAACAGTTCGAATTCGCCAATCAGGATACAGCTCCAAATATTCTTTCCAGGAT
TTTGTGAGCCACTTCCATGTACTTCTTCCCCGAAATATTATTCCATCCAAATTTAACATT
CAGGATTTCTTCAGGAAAATAAATCTTAATCCAGATAATTATCAAGTTGGAAAAACCATG
GTCTTTCTAAAGGAGCAGGAACGACAGCACTTACAAGATCTGCTTCACCAAGAGGTGCTC
CGCAGAATCATATTGTTGCAGCGATGGTTCAGGGTCTTGCTGTGTAGGCAGCATTTCCTC
CATCTGAGACAAGCATCTGTTATTATCCAGAGATTCTGGAGGAATTACCTAAATCAGAAG
CAAGTCAGAGATGCAGCTGTGCAGAAGGATGCTTTTGTTATGGCTAGTGCAGCTGCTCTT
CTCCAAGCTTCCTGGCGTGCTCACTTAGAGAGGCAGCGGTACTTGGAGTTACGGGCTGCA
GCCATCGTTATCCAGCAGAAATGGAGAGATTACTATAGGCGCAGGCACATGGCTGCTATT
TGCATACAAGCAAGATGGAAAGCCTACAGGGAAAGTAAAAGGTACCAAGAACAAAGGAAA
AAAATTATCCTTTTGCAATCAACATGTAGAGGATTCAGAGCAAGACAAAGATTTAAAGCT
TTAAAAGAACAAAGGCTAAGAGAAACAAAGCCAGAAGTTGGATTGGTGAATATTAAGGGA
TATGGATCTCTGGAAATTCAGGGTTCAGACCCTTCAGGATGGGAGGATTGTTCTTTTGAC
AACAGAATAAAAGCCATAGAGGAATGTAAATCTGTAATAGAGAGTAATCGAATTAGCCGT
GAAAGTTCAGTGGACTGCTTGAAGGAGTCACCAAACAAGCAGCAGGAGAGAGCCCAAAGC
CAGAGTGGTGTGGACTTGCAGGAAGATGTGCTTGTAAGAGAGAGACCCAGATCCTTGGAG
GATCTCCATCAGAAAAAAGTAGGCCGGGCTAAGAGAGAAAGTAGGAGAATGAGAGAACTA
GAGCAAGCTATATTTAGCTTAGAATTGCTGAAAGTTCGTTCTCTTGGTGGTATTTCTCCT
TCAGAGGATCGCAGATGGTCTACAGAATTGGTGCCTGAAGGCCTTCAGTCTCCACGGGGT
ACACCTGATAGTGAGAGCTCTCAAGGAAGCTTGGAACTTCTGAGCTATGAGGAAAGCCAA
AAGAGCAAACTAGAGTCTGTCATTTCAGATGAAGGAGACTTGCAGTTTCCATCACCTAAG
ATATCCAGCAGTCCAAAATTTGATTCACGGGACAATGCCCTCAGTGCCTCAAATGAGACT
AGCAGTGCAGAGCATTTGAAGGATGGAACTATGAAGGAAATGGTGGTCTGCAGTTCTGAG
TCTATTACCTGTAAACCACAGCTGAAAGACTCCTTCATTTCAAATAGTCTACCTACTTTT
TTTTATATCCCCCAACAAGACCCACTGAAAACAAATTCCCAACTAGACACAAGTATCCAA
AGAAACAAACTATTGGAAAATGAAGACACAGCGGGGGAAGCTCTTACTTTGGATATCAAC
AGGGAAACTAGAAGGTATCACTGCTCAGGAAAAGATCAGATTGTTCCTTCTTTGAATACA
GAGTCTTCTAATCCTGTGCTTAAGAAGTTAGAAAAGCTAAACACTGAGAAGGAAGAAAGG
CAAAAACAGTTGCAGCAACAGAATGAAAAAGAGATGATGGAACAGATTCGCCAGCAAACA
GATATTTTAGAGAAGGAGCGCAAAGCCTTCAAGACAATTGAAAAGCCAAGAATTGGAGAG
TGTTTGGTGGCACCATCTTCCTATCAGTCAAAGCAAAGAGTAGAGAGGCCATCCTCTCTC
CTCAGCTTAAATACCTCAAATAAGGGAGAACTTAATGTACTGGGGTCCCTATCATTAAAA
GATGCAGCTCTTGCCCAAAAAGACAGTTCCTCTGCTCACTTACCCCCAAAGGACCGACCT
GTCACCGTGTTCTTTGAAAGAAAAGGAAGTCCATGCCAATCTAGTACTGTCAAGGAATTA
TCCAAGACAGACAGAATGGGCACCCAGCTGAATGTAGCCTGTAAACTCTCAAATAATCGC
ATTTCAAAAAGAGAACACTTTAGGCCAACTCAGTCTTACAGCCACAATTCTGATGACCTT
TCCAGAGAGGGAAATGCTAGGCCCATTTTCTTCACTCCAAAGGACAATATGAGTATTCCC
CTTGTCAGCAAAGAAGCCTTAAACAGTAAAAATCCTCAACTCCATAAAGAAGATGAACCA
GCATGGAAACCTGTGAAGTTAGCTGGGCCAGGCCAAAGAGAGACATCACAGCGATTTTCG
TCAGTTGATGAACAAGCAAAACTTCATAAGACTATGTCTCAAGGAGAGATTACCAAGTTG
GCAGTGAGACAGAAGGCTTCAGATTCAGATATAAGACCTCAGAGAGCTAAGATGAGATTC
TGGGCCAAAGGGAAACAAGGGGAGAAGAAGACTACCAGAGTGAAACCTACTACCCAGTCA
GAGGTTTCGCCACTCTTTGCAGGCACAGATGTGATTCCAGCTCATCAGTTTCCAGATGAA
TTAGCTGCATATCACCCAACACCTCCTTTGAGCCCAGAACTGCCCGGCAGTTGCCGGAAG
GAATTCAAAGAGAACAAAGAACCTTCTCCAAAGGCTAAGCGCAAGCGAAGTGTGAAGATT
AGCAACGTGGCTTTGGATTCTATGCATTGGCAAAATGACTCTGTCCAGATCATAGCAAGT
GTCAGTGATTTAAAAAGCATGGATGAATTTCTTCTGAAAAAGGTGAATGACCTAGATAAT
GAAGACAGCAAGAAGGATACACTAGTGGATGTTGTATTTAAAAAAGCCCTGAAGGAATTT
CGGCAGAATATCTTCAGCTTTTATTCATCTGCATTGGCGATGGATGATGGGAAAAGCATA
CGGTATAAAGACCTCTATGCACTATTTGAACAGATTCTGGAAAAGACGATGAGGCTTGAG
CAGCGTGATTCACTGGGTGAATCTCCAGTGAGAGTTTGGGTCAACACTTTTAAAGTGTTT
TTAGATGAATATATGAATGAATTCAAGACTTCAGATTGCACAGCCACAAAGGTGCCAAAA
ACAGAAAGAAAGAAAAGAAGGAAAAAGGAAACTGATTTGGTGGAAGAACACAATGGTCAC
ATCTTTAAAGCCACCCAATATAGCATCCCTACATACTGTGAATACTGTTCTTCTTTGATA
TGGATAATGGACCGAGCCTCTGTTTGCAAATTATGCAAGTATGCTTGCCATAAGAAGTGC
TGTCTGAAAACCACAGCCAAGTGCTCTAAAAAGTATGATCCAGAGCTGTCATCTCGACAA
TTTGGGGTTGAACTGTCCCGTTTGACCAGTGAAGACCGAACTGTTCCTTTAGTAGTGGAA
AAGCTCATAAACTACATTGAAATGCATGGACTGTATACAGAAGGTATTTATCGAAAGTCT
GGTTCGACTAATAAAATCAAGGAGCTTCGGCAGGGTCTAGATACAGATGCTGAGAGTGTA
AATCTAGATGACTATAACATACACGTCATTGCAAGTGTATTCAAACAATGGCTTCGAGAT
TTGCCCAATCCTCTCATGACCTTTGAACTCTATGAGGAATTTCTTCGAGCTATGGGCCTT
CAGGAGAGGAAGGAGACAATCCGTGGTGTATACTCTGTGATTGATCAACTCTCCCGAACT
CATCTCAATACACTGGAACGCCTCATCTTTCATCTAGTCAGGATTGCTCTGCAGGAAGAC
ACTAATCGAATGTCTGCTAATGCTTTGGCCATTGTGTTTGCGCCCTGCATTCTCCGCTGC
CCTGACACCACTGACCCACTACAAAGTGTACAGGACATCAGTAAGACTACCACTTGTGTG
GAACTGATTGTTGTGGAACAAATGAATAAATACAAGGCTCGTCTCAAAGATATCAGTAGC
TTGGAATTTGCTGAGAATAAGGCAAAGACCAGGTTGTCACTGATTCGTAGATCAATGGGA
AAGGGGCGTATTCGTCGAGGAAACTATCCAGGTCCATCGTCTCCTGTTGTAGTTCGGTTG
CCTTCTGTGTCTGATGTCTCAGAGGAGACCTTGACTAGTGAGGCAGCCATGGAGACTGAC
ATCACAGAACAGCAGCAAGCAGCTATGCAGCAGGAGGAGAGAGTACTGACTGAGCAGATT
GAGAACCTACAGAAGGAGAAGGAGGAGCTAACATTTGAGATGCTTGTACTGGAACCCCGT
GCCTCTGATGATGAAACCCTTGAGTCTGAGGCCTCCATTGGGACTGCTGATAGCTCAGAG
AATTTGAATATGGAGTCTGAATATGCTATCTCTGAGAAATCAGAAAGAAGCTTAGCCCTT
AGCTCCCTGAAGACAGCTGGCAAGTCTGAACCTTCCAGCAAGTTGCGAAAGCAACTTAAA
AAGCAGCAAGACTCTTTAGATGTCGTGGACTCTTCGGTCTCCTCTTTATGTCTGTCTAAC
ACGGCATCATCTCATGGGACCAGAAAACTATTTCAGATTTATTCCAAATCTCCATTCTAC
CGAGCTGCCTCAGGTAATGAGGCCCTGGGAATGGAAGGACCATTGGGCCAGACCAAATTC
CTGGAAGACAAGCCTCAGTTCATCAGCAGAGGAACCTTCAACCCGGAAAAGGGCAAACAA
AAATTAAAGAATGTGAAAAACTCACCTCAGAAAACCAAAGAGACCCCAGAGGGGACAGTC
ATGTCTGGCCGCAGAAAAACTGTGGACCCAGACTGCACCTCCAACCAACAGCTAGCACTC
TTTGGAAATAATGAATTTATGGTCTGA
Protein Properties
Number of Residues 2548
Molecular Weight 292703.0
Theoretical pI 9.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 175-195
Protein Sequence
>Myosin-IXa
MNINDGGRRRFEDNEHTLRIYPGAISEGTIYCPIPARKNSTAAEVIESLINKLHLDKTKC
YVLAEVKEFGGEEWILNPTDCPVQRMMLWPRMALENRLSGEDYRFLLREKNLDGSIHYGS
LQSWLRVTEERRRMMERGFLPQPQQKDFDDLCSLPDLNEKTLLENLRNRFKHEKIYTYVG
SILIVINPFKFLPIYNPKYVKMYDNHQLGKLEPHIYAVADVAYHAMLQRKKNQCIVISGE
SGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVNYQETGTVLGAYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEDERSAFHLKQPEE
YHYLNQITKKPLRQSWDDYCYDSEPDCFTVEGEDLRHDFERLQLAMEMVGFLPKTRRQIF
SLLSAILHLGNICYKKKTYRDDSIDICNPEVLPIVSELLEVKEEMLFEALVTRKTVTVGE
KLILPYKLAEAVTVRNSMAKSLYSALFDWIVFRINHALLNSKDLEHNTKTLSIGVLDIFG
FEDYENNSFEQFCINFANERLQHYFNQHIFKLEQEEYRTEGISWHNIDYIDNTCCINLIS
KKPTGLLHLLDEESNFPQATNQTLLDKFKHQHEDNSYIEFPAVMEPAFIIKHYAGKVKYG
VKDFREKNTDHMRPDIVALLRSSKNAFISGMIGIDPVAVFRWAILRAFFRAMVAFREAGK
RNIHRKTGHDDTAPCAILKSMDSFSFLQHPVHQRSLEILQRCKEEKYSITRKNPRTPLSD
LQGMNALNEKNQHDTFDIAWNGRTGIRQSRLSSGTSLLDKDGIFANSTSSKLLERAHGIL
TRNKNFKSKPALPKHLLEVNSLKHLTRLTLQDRITKSLLHLHKKKKPPSISAQFQASLSK
LMETLGQAEPYFVKCIRSNAEKLPLRFSDVLVLRQLRYTGMLETVRIRQSGYSSKYSFQD
FVSHFHVLLPRNIIPSKFNIQDFFRKINLNPDNYQVGKTMVFLKEQERQHLQDLLHQEVL
RRIILLQRWFRVLLCRQHFLHLRQASVIIQRFWRNYLNQKQVRDAAVQKDAFVMASAAAL
LQASWRAHLERQRYLELRAAAIVIQQKWRDYYRRRHMAAICIQARWKAYRESKRYQEQRK
KIILLQSTCRGFRARQRFKALKEQRLRETKPEVGLVNIKGYGSLEIQGSDPSGWEDCSFD
NRIKAIEECKSVIESNRISRESSVDCLKESPNKQQERAQSQSGVDLQEDVLVRERPRSLE
DLHQKKVGRAKRESRRMRELEQAIFSLELLKVRSLGGISPSEDRRWSTELVPEGLQSPRG
TPDSESSQGSLELLSYEESQKSKLESVISDEGDLQFPSPKISSSPKFDSRDNALSASNET
SSAEHLKDGTMKEMVVCSSESITCKPQLKDSFISNSLPTFFYIPQQDPLKTNSQLDTSIQ
RNKLLENEDTAGEALTLDINRETRRYHCSGKDQIVPSLNTESSNPVLKKLEKLNTEKEER
QKQLQQQNEKEMMEQIRQQTDILEKERKAFKTIEKPRIGECLVAPSSYQSKQRVERPSSL
LSLNTSNKGELNVLGSLSLKDAALAQKDSSSAHLPPKDRPVTVFFERKGSPCQSSTVKEL
SKTDRMGTQLNVACKLSNNRISKREHFRPTQSYSHNSDDLSREGNARPIFFTPKDNMSIP
LVSKEALNSKNPQLHKEDEPAWKPVKLAGPGQRETSQRFSSVDEQAKLHKTMSQGEITKL
AVRQKASDSDIRPQRAKMRFWAKGKQGEKKTTRVKPTTQSEVSPLFAGTDVIPAHQFPDE
LAAYHPTPPLSPELPGSCRKEFKENKEPSPKAKRKRSVKISNVALDSMHWQNDSVQIIAS
VSDLKSMDEFLLKKVNDLDNEDSKKDTLVDVVFKKALKEFRQNIFSFYSSALAMDDGKSI
RYKDLYALFEQILEKTMRLEQRDSLGESPVRVWVNTFKVFLDEYMNEFKTSDCTATKVPK
TERKKRRKKETDLVEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRASVCKLCKYACHKKC
CLKTTAKCSKKYDPELSSRQFGVELSRLTSEDRTVPLVVEKLINYIEMHGLYTEGIYRKS
GSTNKIKELRQGLDTDAESVNLDDYNIHVIASVFKQWLRDLPNPLMTFELYEEFLRAMGL
QERKETIRGVYSVIDQLSRTHLNTLERLIFHLVRIALQEDTNRMSANALAIVFAPCILRC
PDTTDPLQSVQDISKTTTCVELIVVEQMNKYKARLKDISSLEFAENKAKTRLSLIRRSMG
KGRIRRGNYPGPSSPVVVRLPSVSDVSEETLTSEAAMETDITEQQQAAMQQEERVLTEQI
ENLQKEKEELTFEMLVLEPRASDDETLESEASIGTADSSENLNMESEYAISEKSERSLAL
SSLKTAGKSEPSSKLRKQLKKQQDSLDVVDSSVSSLCLSNTASSHGTRKLFQIYSKSPFY
RAASGNEALGMEGPLGQTKFLEDKPQFISRGTFNPEKGKQKLKNVKNSPQKTKETPEGTV
MSGRRKTVDPDCTSNQQLALFGNNEFMV
GenBank ID Protein 156119615
UniProtKB/Swiss-Prot ID B2RTY4
UniProtKB/Swiss-Prot Entry Name MYO9A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006901.2
GeneCard ID MYO9A
GenAtlas ID MYO9A
HGNC ID HGNC:7608
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]
  5. Bement WM, Hasson T, Wirth JA, Cheney RE, Mooseker MS: Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types. Proc Natl Acad Sci U S A. 1994 Jul 5;91(14):6549-53. [PubMed:8022818 ]
  6. Gorman SW, Haider NB, Grieshammer U, Swiderski RE, Kim E, Welch JW, Searby C, Leng S, Carmi R, Sheffield VC, Duhl DM: The cloning and developmental expression of unconventional myosin IXA (MYO9A) a gene in the Bardet-Biedl syndrome (BBS4) region at chromosome 15q22-q23. Genomics. 1999 Jul 15;59(2):150-60. [PubMed:10409426 ]
  7. Chieregatti E, Gartner A, Stoffler HE, Bahler M: Myr 7 is a novel myosin IX-RhoGAP expressed in rat brain. J Cell Sci. 1998 Dec 18;111 ( Pt 24):3597-608. [PubMed:9819351 ]
  8. Hiller M, Huse K, Platzer M, Backofen R: Non-EST based prediction of exon skipping and intron retention events using Pfam information. Nucleic Acids Res. 2005 Oct 4;33(17):5611-21. Print 2005. [PubMed:16204458 ]