You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10970
Secondary Accession Numbers
  • 17284
Name Putative pleckstrin homology domain-containing family M member 1P
Synonyms Not Available
Gene Name PLEKHM1P
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 17q24.1
SNPs PLEKHM1P
Gene Sequence
>1563 bp
ATGGGACTGTCCAACCCATTCCAGGGTCTCATGAAGCTGGGCACCGTGGAGCGGCAGGGG
GCAATGGGCATCTGGAAGGAGCTCTTCTGCGAGCTCTCCCCACTGGAGTTCCGCCTCTAC
CTGAGCAACGAGGAGCACACCTGTGTGGAGAACTGCTCCCTGCTTCGCTGTGAGTCTGTG
GGGCCAGCCCACAGTGACGGGCGCTTTGAGCTGGTCTTCTCTGGCAAGAAGCTGGCCCTG
CGCGCCTCCTCCCAGGACGAAGCTGAGGACTGGCTGGACCTGGTGCGGGAGGCCCTGCAG
AAGGTCCGGCCTCAGCAGGAGGATGAGTGGGTGAACGTGCAGTACTCAGACCAGCCTGAG
GAACCCCCCGAGGCGCCCCAGGGCTGCCTCTCTCCCTCAGACCTGCTCTCGGAGCCCGCG
GCCCTCCAGGGCACACAGTCTGACTGGTCGTCCGCCCAGGTTCCAGAGCTAGATGCCATC
AAGGAGTCCCTGCTGTACTTGTACATGGACAGGACCTGGATGCCCTATATATTTTCTCTG
CCCTTGGAGGCTCTGAAATGTTTCCGCATCAGGAACAATGAGAAGATGCTGAGTGACAGC
CACGGCGTGGAGACCATCCGGGACATCCTGCCAGACACCAGCCTTGGGGGCCCATCCTTC
TTCAAAATCATCACGGCCAAGGCTGTCCTGAAGCTGCAGGCCGGAAACGCCGAGGAAGCC
GCCCTGTGGAGGGATCTGGTCCGCAAAGTCCTGGCATCCTACTTGGAGACAGCCGAGGAG
GCGGTGACCCTGGGCGGGAGCCTGGATGAAAACTGTCAGGAGGTGCTGAAATTTGCCACC
CGGGAGAATGGCTTCCTGCTGCAGTACCTGGTGGCCATCCCCATGGAGAAAGGCCTTGAC
TCCCAAGGCTGCTTCTGCGCAGGCTGCTCCCGGCAGATCGGCTTCTCCTTTGTACGACCC
AAGCTCTGTGCCTTCTCTGGCCTCTATTACTGTGACATCTGCCACCAAGACGATGCCTCA
GTGATTCCGGCCAGGATCATCCACAACTGGGACCTCACCAAGCGCCCGATCTGCAGGCAG
GCCCTGAAGTTTCTGACGCAGATCCGGGCCCAGCCCCTCATCAACCTGCAGATGGTGAAC
GCGTCTCTGTACGAGCATGTGGAGCGGATGCACCTCATTGGGAGGAGCCGGGAGCAGCTG
AAGCTCCTGGGGGATTACCTGGGCCTGTGCCGGAGTGGCGCCCTGAAGGAGCTCAGCAAG
AGGCTCAACCACCGGAATTATCTCTTGGAGTCTCCGCATAGGTTCCGTGTTGCTGACCTC
CGGCAGATCGCAGATGAGGTATATGAAGGATTCCTCAAGGCCCTGATTGAATTTGCCTCC
CAGCATGTCTACCACTGCGACCTGTGCACCCAGCGCAGCTTCATCTGCCAGATCTGCCAG
CACCACGACATCATCTTCCCCTCTGAGTTTGACACCACAGTCAGGTGTGCCAAGTGCAAG
ACCGTCTTCCACCAGAGCTGCCAGGCTGTGGTGAAGAAGGGCTGCCCCCGCTGTGCTCGC
TGA
Protein Properties
Number of Residues 520
Molecular Weight 58972.1
Theoretical pI 6.28
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Putative pleckstrin homology domain-containing family M member 1P
MGLSNPFQGLMKLGTVERQGAMGIWKELFCELSPLEFRLYLSNEEHTCVENCSLLRCESV
GPAHSDGRFELVFSGKKLALRASSQDEAEDWLDLVREALQKVRPQQEDEWVNVQYSDQPE
EPPEAPQGCLSPSDLLSEPAALQGTQSDWSSAQVPELDAIKESLLYLYMDRTWMPYIFSL
PLEALKCFRIRNNEKMLSDSHGVETIRDILPDTSLGGPSFFKIITAKAVLKLQAGNAEEA
ALWRDLVRKVLASYLETAEEAVTLGGSLDENCQEVLKFATRENGFLLQYLVAIPMEKGLD
SQGCFCAGCSRQIGFSFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKRPICRQ
ALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGRSREQLKLLGDYLGLCRSGALKELSK
RLNHRNYLLESPHRFRVADLRQIADEVYEGFLKALIEFASQHVYHCDLCTQRSFICQICQ
HHDIIFPSEFDTTVRCAKCKTVFHQSCQAVVKKGCPRCAR
GenBank ID Protein 50949528
UniProtKB/Swiss-Prot ID Q69YJ1
UniProtKB/Swiss-Prot Entry Name PKHMP_HUMAN
PDB IDs Not Available
GenBank Gene ID AL833315
GeneCard ID PLEKHM1P
GenAtlas ID PLEKHM1P
HGNC ID HGNC:35411
References
General References
  1. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  2. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]