You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10971
Secondary Accession Numbers
  • 17285
Name SH3 and cysteine-rich domain-containing protein
Synonyms
  1. Src homology 3 and cysteine-rich domain-containing protein
Gene Name STAC
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Probably involved in a neuron-specific signal transduction
Pathways Not Available
Reactions Not Available
GO Classification
Process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:3
Locus 3p22.3
SNPs STAC
Gene Sequence
>1209 bp
ATGATCCCTCCGAGCAGCCCCCGCGAGGACGGCGTGGACGGGCTGCCCAAGGAGGCGGTG
GGCGCCGAGCAACCGCCCTCTCCTGCATCCACCAGCAGCCAGGAATCCAAGCTCCAGAAA
CTAAAACGATCACTTTCTTTCAAGACCAAGAGTTTACGGAGCAAAAGTGCTGACAACTTC
TTCCAGCGAACCAACAGCGAAGACATGAAACTGCAAGCACACATGGTGGCTGAGATCAGC
CCCAGCTCCAGCCCACTCCCTGCTCCAGGAAGCCTGACGTCCACACCCGCCAGGGCTGGT
CTGCATCCAGGTGGCAAGGCTCATGCCTTTCAGGAATACATCTTCAAGAAGCCCACTTTC
TGTGATGTCTGCAACCACATGATAGTGGGAACAAATGCTAAGCATGGACTGCGCTGCAAA
GCCTGTAAGATGAGCATCCACCACAAGTGCACAGATGGCCTGGCACCCCAGCGGTGCATG
GGCAAGCTGCCAAAGGGGTTTCGGCGTTACTACAGCTCCCCCTTGCTCATTCATGAACAG
TTTGGCTGCATTAAAGAAGTTATGCCCATTGCCTGTGGCAATAAGGTGGACCCTGTCTAC
GAGACCCTCCGCTTCGGCACCTCCCTGGCCCAGAGGACAAAGAAGGGCAGCTCCGGCAGT
GGCTCTGACTCACCTCACAGAACCTCTACTTCAGATCTTGTGGAGGTTCCTGAGGAAGCC
AATGGGCCAGGAGGCGGGTATGACCTAAGGAAACGCAGCAACAGCGTGTTTACATATCCA
GAAAATGGCACTGATGATTTCAGAGATCCAGCGAAGAACATAAACCACCAGGGATCTCTT
TCCAAAGACCCATTACAGATGAACACCTATGTTGCCTTGTACAAATTTGTACCACAGGAG
AATGAAGATTTGGAAATGAGGCCAGGAGACATAATTACTCTTTTAGAGGATTCCAATGAA
GACTGGTGGAAAGGGAAAATTCAAGACAGAATTGGCTTCTTTCCAGCCAACTTTGTTCAG
AGACTACAACAAAATGAGAAGATTTTTAGATGTGTTAGAACCTTCATTGGGTGTAAGGAA
CAGGGGCAGATAACACTGAAAGAGAATCAGATCTGCGTGAGTTCTGAAGAAGAACAAGAT
GGTTTTATCAGAGTCCTCAGTGGAAAAAAGAAAGGCCTCATCCCCCTTGATGTACTAGAA
AACATCTGA
Protein Properties
Number of Residues 402
Molecular Weight 44553.2
Theoretical pI 8.6
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>SH3 and cysteine-rich domain-containing protein
MIPPSSPREDGVDGLPKEAVGAEQPPSPASTSSQESKLQKLKRSLSFKTKSLRSKSADNF
FQRTNSEDMKLQAHMVAEISPSSSPLPAPGSLTSTPARAGLHPGGKAHAFQEYIFKKPTF
CDVCNHMIVGTNAKHGLRCKACKMSIHHKCTDGLAPQRCMGKLPKGFRRYYSSPLLIHEQ
FGCIKEVMPIACGNKVDPVYETLRFGTSLAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEA
NGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTYVALYKFVPQE
NEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLQQNEKIFRCVRTFIGCKE
QGQITLKENQICVSSEEEQDGFIRVLSGKKKGLIPLDVLENI
GenBank ID Protein 189069243
UniProtKB/Swiss-Prot ID Q99469
UniProtKB/Swiss-Prot Entry Name STAC_HUMAN
PDB IDs Not Available
GenBank Gene ID AK313493
GeneCard ID STAC
GenAtlas ID STAC
HGNC ID HGNC:11353
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Suzuki H, Kawai J, Taga C, Yaoi T, Hara A, Hirose K, Hayashizaki Y, Watanabe S: Stac, a novel neuron-specific protein with cysteine-rich and SH3 domains. Biochem Biophys Res Commun. 1996 Dec 24;229(3):902-9. [PubMed:8954993 ]