Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10973
Secondary Accession Numbers
  • 17287
Name Ras guanyl-releasing protein 3
Synonyms
  1. Calcium and DAG-regulated guanine nucleotide exchange factor III
  2. Guanine nucleotide exchange factor for Rap1
Gene Name RASGRP3
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Guanine nucleotide exchange factor (GEF) for Ras and Rap1
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
calcium ion binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signaling pathway
signaling
signaling pathway
intracellular signal transduction
small gtpase mediated signal transduction
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 2p25.1-p24.1
SNPs RASGRP3
Gene Sequence
>2073 bp
ATGGGATCAAGTGGCCTTGGGAAAGCAGCAACATTAGATGAACTGCTGTGCACTTGCATT
GAGATGTTTGATGACAATGGAGAGCTGGATAATAGTTATTTGCCAAGAATAGTTCTACTG
ATGCACCGATGGTATTTATCTTCCACTGAATTGGCAGAAAAACTTCTCTGCATGTATCGA
AATGCCACTGGAGAAAGCTGCAATGAATTTCGATTAAAGATCTGCTACTTCATGAGGTAC
TGGATTCTGAAGTTTCCTGCAGAGTTTAATTTGGATCTTGGTTTGATTCGTATGACTGAG
GAATTTCGGGAAGTAGCTAGTCAACTAGGATATGAAAAACACGTCAGCCTCATCGACATA
TCCAGCATTCCTTCCTATGACTGGATGAGAAGAGTCACACAGAGGAAAAAAGTATCCAAG
AAGGGAAAAGCCTGTCTGCTGTTTGACCATCTGGAGCCCATTGAATTGGCTGAGCACCTC
ACTTTTCTGGAGCATAAATCTTTTAGAAGGATCTCATTCACTGATTACCAAAGCTATGTC
ATCCATGGCTGCCTGGAGAATAATCCAACCTTGGAAAGATCGATTGCTTTATTTAATGGA
ATCTCTAAGTGGGTCCAGTTGATGGTTCTTAGCAAACCAACCCCCCAGCAAAGGGCAGAA
GTCATCACAAAGTTTATCAATGTTGCAAAGAAGCTCCTTCAGCTCAAAAATTTTAACACC
CTGATGGCAGTGGTGGGAGGCCTCAGTCATAGTTCCATTTCACGCCTCAAAGAGACCCAT
TCTCATCTTTCTTCAGAAGTTACAAAGAACTGGAATGAAATGACAGAGTTGGTCTCCTCC
AACGGCAATTACTGCAATTACCGCAAGGCCTTTGCCGACTGCGATGGCTTCAAAATCCCC
ATCCTTGGAGTACACTTGAAAGACTTGATAGCTGTCCATGTCATTTTCCCAGACTGGACA
GAGGAGAACAAAGTGAACATTGTGAAAATGCACCAGCTCTCCGTTACCCTGAGTGAACTA
GTCTCCCTGCAGAATGCCTCTCACCACTTAGAACCCAACATGGATTTGATCAACCTGCTC
ACGCTTTCCCTGGACCTCTATCACACTGAAGATGATATTTACAAACTGTCACTGGTGCTG
GAGCCTAGAAATTCTAAATCGCAGCCTACCTCCCCTACGACGCCCAACAAGCCTGTGGTA
CCCCTGGAGTGGGCATTAGGGGTGATGCCAAAGCCAGACCCCACGGTCATCAACAAGCAC
ATAAGGAAATTAGTGGAGTCTGTATTTAGAAACTATGATCACGACCATGATGGGTACATT
TCCCAAGAGGACTTTGAAAGTATAGCTGCCAATTTTCCCTTCTTGGATTCCTTCTGTGTT
CTGGACAAAGATCAGGATGGCCTAATTAGTAAAGATGAAATGATGGCTTACTTCCTGAGA
GCTAAATCCCAACTACACTGTAAAATGGGACCAGGATTTATCCATAATTTTCAGGAGATG
ACCTATCTCAAGCCAACCTTCTGCGAACACTGTGCGGGATTTCTCTGGGGCATAATCAAG
CAAGGATACAAATGCAAAGACTGTGGAGCCAATTGTCACAAACAGTGCAAAGACCTCCTG
GTTCTGGCCTGCAGGAGATTTGCCCGGGCGCCCTCCTTGAGCAGTGGTCATGGGTCACTG
CCTGGAAGCCCCTCGCTGCCCCCAGCGCAGGATGAGGTGTTTGAGTTCCCTGGAGTCACT
GCTGGACACAGGGATTTAGACAGCAGAGCCATCACACTGGTTACAGGCTCTTCTCGCAAG
ATCTCTGTGAGGCTACAGAGGGCCACCACCAGCCAGGCCACCCAGACTGAACCTGTCTGG
TCAGAGGCTGGCTGGGGGGACTCGGGGTCCCACACCTTCCCTAAAATGAAATCCAAGTTC
CATGACAAAGCAGCAAAGGACAAAGGCTTTGCCAAATGGGAAAATGAGAAGCCCAGGGTG
CATGCTGGTGTGGATGTTGTAGACCGGGGCACGGAGTTTGAACTTGACCAGGATGAAGGA
GAAGAGACCAGACAGGATGGTGAGGATGGCTGA
Protein Properties
Number of Residues 690
Molecular Weight 78330.9
Theoretical pI 6.79
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ras guanyl-releasing protein 3
MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYR
NATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRV
HAGVDVVDRGTEFELDQDEGEETRQDGEDG
GenBank ID Protein 213385270
UniProtKB/Swiss-Prot ID Q8IV61
UniProtKB/Swiss-Prot Entry Name GRP3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001139488.1
GeneCard ID RASGRP3
GenAtlas ID RASGRP3
HGNC ID HGNC:14545
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [PubMed:10048485 ]
  4. Rebhun JF, Castro AF, Quilliam LA: Identification of guanine nucleotide exchange factors (GEFs) for the Rap1 GTPase. Regulation of MR-GEF by M-Ras-GTP interaction. J Biol Chem. 2000 Nov 10;275(45):34901-8. [PubMed:10934204 ]