You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10975
Secondary Accession Numbers
  • 17289
Name Oxysterol-binding protein-related protein 1
Synonyms
  1. ORP-1
  2. OSBP-related protein 1
Gene Name OSBPL1A
Protein Type Unknown
Biological Properties
General Function Involved in steroid metabolic process
Specific Function Binds phospholipids; exhibits strong binding to phosphatidic acid and weak binding to phosphatidylinositol 3- phosphate
Pathways Not Available
Reactions Not Available
GO Classification
Process
metabolic process
primary metabolic process
lipid metabolic process
steroid metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 18q11.1
SNPs OSBPL1A
Gene Sequence
>2853 bp
ATGAACACAGAAGCGGAGCAACAGCTTCTCCATCACGCCAGAAATGGCAATGCTGAAGAA
GTAAGACAACTATTAGAGACCATGGCGAGGAATGAAGTGATTGCTGACATTAATTGCAAA
GGAAGAAGTAAGTCTAACTTGGGCTGGACACCTCTACATCTGGCATGCTATTTTGGACAC
AGACAAGTGGTCCAGGATCTGTTGAAGGCTGGTGCAGAAGTGAATGTGTTGAATGACATG
GGAGACACGCCGCTTCATCGAGCTGCCTTTACAGGACGAAAGGAGTTGGTAATGCTTCTC
TTAGAATATAATGCTGATACTACTATTGTTAATGGGAGTGGACAGACAGCAAAAGAAGTT
ACTCATGCTGAAGAAATCAGAAGCATGCTTGAAGCTGTAGAAAGGACTCAACAAAGAAAG
CTTGAAGAATTACTTTTAGCAGCAGCAAGAGAAGGCAAAACAACAGAACTCACAGCTCTG
CTCAACAGGCCCAATCCTCCTGATGTTAACTGTTCGGATCAGTTAGGAAATACACCCTTG
CATTGTGCAGCTTACCGGGCCCATAAACAATGTGCCTTAAAGCTTCTAAGAAGTGGAGCA
GACCCTAATCTGAAGAACAAAAATGATCAGAAACCTCTTGACCTTGCCCAGGGTGCTGAA
ATGAAACACATTCTTGTTGGTAATAAGGTCATCTACAAAGCATTGAAACGATATGAGGGC
CCTCTCTGGAAGAGTTCAAGATTTTTTGGCTGGAGATTATTCTGGGTAGTGTTAGAGCAT
GGAGTCCTTTCATGGTATAGGAAACAGCCTGATGCAGTTCATAATATTTATCGCCAGGGA
TGCAAACACCTGACTCAAGCAGTATGCACGGTAAAATCCACTGATAGCTGCCTCTTCTTT
ATTAAATGCTTTGATGACACCATTCATGGCTTCCGGGTTCCTAAGAATAGCCTTCAGCAG
TCAAGAGAGGACTGGCTGGAAGCAATAGAAGAACATTCTGCTTACAGCACTCACTACTGT
TCCCAGGACCAGCTGACTGATGAGGAGGAGGAAGATACGGTTTCTGCTGCAGACCTGAAG
AAATCATTAGAGAAAGCACAGTCATGCCAACAGCGACTAGATAGGGAAATTTCCAACTTT
CTCAAAATGATTAAGGAGTGTGACATGGCTAAAGAAATGCTTCCATCATTTCTTCAGAAA
GTTGAAGTTGTCTCAGAAGCTTCTAGAGAAACTTGTGTAGCTTTGACTGATTGCCTTAAT
CTCTTCACCAAACAAGAAGGGGTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAAC
AAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCT
CTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTG
TCAGATTCCGAGTCCGAAAGGTCCCTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTT
GAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAAGACTGT
GGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCT
ATGTTTTCCAGAAATGACTTCAGTATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAA
CTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAGCGCCTA
ACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTG
GAAAGGATGCAGTGTGTAGCTGCGTTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGG
ACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGATGACCTT
GGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCT
GAAGGATTAAACAATGACTTCATCTTTCATGGCTCTATCTATCCCAAACTGAAATTCTGG
GGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAACACAAT
GAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTG
TGGATCGAACAGTATGGCAATGTGGAAATTATAAACCACAAGACTGGGGACAAATGTGTG
TTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGCTACATT
CAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATAC
AGTGTTGACCCTGCCACGTTTGACGCTTACAAAAAAAATGATAAGAAAAATACAGAAGAG
AAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTGCCGGAT
TCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCT
CCAAATTCTGCCCAGATGTATAATTTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGAC
AAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATCAGAGCC
ATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAA
AGAGCAGCCCGCAAAAACAGGTCCAAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCAT
CAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTACTGGGAC
AGAAATTACTTCAATTTGCCTGACATTTATTAA
Protein Properties
Number of Residues 950
Molecular Weight 108469.0
Theoretical pI 6.33
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Oxysterol-binding protein-related protein 1
MNTEAEQQLLHHARNGNAEEVRQLLETMARNEVIADINCKGRSKSNLGWTPLHLACYFGH
RQVVQDLLKAGAEVNVLNDMGDTPLHRAAFTGRKELVMLLLEYNADTTIVNGSGQTAKEV
THAEEIRSMLEAVERTQQRKLEELLLAAAREGKTTELTALLNRPNPPDVNCSDQLGNTPL
HCAAYRAHKQCALKLLRSGADPNLKNKNDQKPLDLAQGAEMKHILVGNKVIYKALKRYEG
PLWKSSRFFGWRLFWVVLEHGVLSWYRKQPDAVHNIYRQGCKHLTQAVCTVKSTDSCLFF
IKCFDDTIHGFRVPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEEEDTVSAADLK
KSLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEASRETCVALTDCLN
LFTKQEGVRNFKLEQEQEKNKILSEALETLATEHHELEQSLVKGSPPASILSEDEFYDAL
SDSESERSLSRLEAVTARSFEEEGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSP
MFSRNDFSIWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPV
ERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVRDDLGFRLISEQVSHHPPISAFHA
EGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLEHNEAYTWTNPTCCVHNIIVGKL
WIEQYGNVEIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALYGKWTECLY
SVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPDSESVFIIPGSVLLWRIAPRP
PNSAQMYNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQ
RAARKNRSKSEEDWKTRWFHQGPNPYNGAQDWIYSGSYWDRNYFNLPDIY
GenBank ID Protein 19718741
UniProtKB/Swiss-Prot ID Q9BXW6
UniProtKB/Swiss-Prot Entry Name OSBL1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_080597.2
GeneCard ID OSBPL1A
GenAtlas ID OSBPL1A
HGNC ID HGNC:16398
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Xu Y, Liu Y, Ridgway ND, McMaster CR: Novel members of the human oxysterol-binding protein family bind phospholipids and regulate vesicle transport. J Biol Chem. 2001 May 25;276(21):18407-14. Epub 2001 Feb 26. [PubMed:11279184 ]
  5. Jaworski CJ, Moreira E, Li A, Lee R, Rodriguez IR: A family of 12 human genes containing oxysterol-binding domains. Genomics. 2001 Dec;78(3):185-96. [PubMed:11735225 ]
  6. Lehto M, Laitinen S, Chinetti G, Johansson M, Ehnholm C, Staels B, Ikonen E, Olkkonen VM: The OSBP-related protein family in humans. J Lipid Res. 2001 Aug;42(8):1203-13. [PubMed:11483621 ]