Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10979
Secondary Accession Numbers
  • 17293
Name ATP-binding cassette sub-family A member 7
Synonyms
  1. ABCA-SSN
  2. Autoantigen SS-N
  3. Macrophage ABC transporter
Gene Name ABCA7
Protein Type Unknown
Biological Properties
General Function Involved in ATP binding
Specific Function Plays a role in phagocytosis by macrophages of apoptotic cells. Binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. May also mediate cholesterol efflux. May regulate cellular ceramide homeostasis during keratinocytes differentiation
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
nucleotide binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
atpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Cell membrane
  2. Golgi apparatus membrane
  3. Endosome membrane
  4. Multi-pass membrane protein
  5. Multi-pass membrane protein
  6. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.3
SNPs ABCA7
Gene Sequence
>6441 bp
ATGGCCTTCTGGACACAGCTGATGCTGCTGCTCTGGAAGAATTTCATGTATCGCCGGAGA
CAGCCGGTCCAGCTCCTGGTCGAATTGCTGTGGCCTCTCTTCCTCTTCTTCATCCTGGTG
GCTGTTCGCCACTCCCACCCGCCCCTGGAGCACCATGAATGCCACTTCCCAAACAAGCCA
CTGCCATCGGCGGGCACCGTGCCCTGGCTCCAGGGTCTCATCTGTAATGTGAACAACACC
TGCTTTCCGCAGCTGACACCGGGCGAGGAGCCCGGGCGCCTGAGCAACTTCAACGACTCC
CTGGTCTCCCGGCTGCTAGCCGATGCCCGCACTGTGCTGGGAGGGGCCAGTGCCCACAGG
ACGCTGGCTGGCCTAGGGAAGCTGATCGCCACGCTGAGGGCTGCACGCAGCACGGCCCAG
CCTCAACCAACCAAGCAGTCTCCACTGGAACCACCCATGCTGGATGTCGCGGAGCTGCTG
ACGTCACTGCTGCGCACGGAATCCCTGGGGTTGGCACTGGGCCAAGCCCAGGAGCCCTTG
CACAGCTTGTTGGAGGCCGCTGAGGACCTGGCCCAGGAGCTCCTGGCGCTGCGCAGCCTG
GTGGAGCTTCGGGCACTGCTGCAGAGACCCCGAGGGACCAGCGGCCCCCTGGAGTTGCTG
TCAGAGGCCCTCTGCAGTGTCAGGGGACCTAGCAGCACAGTGGGCCCCTCCCTCAACTGG
TACGAGGCTAGTGACCTGATGGAGCTGGTGGGGCAGGAGCCAGAATCCGCCCTGCCAGAC
AGCAGCCTGAGCCCCGCCTGCTCGGAGCTGATTGGAGCCCTGGACAGCCACCCGCTGTCC
CGCCTGCTCTGGAGACGCCTGAAGCCTCTGATCCTCGGGAAGCTACTCTTTGCACCAGAT
ACACCTTTTACCCGGAAGCTCATGGCCCAGGTGAACCGGACCTTCGAGGAGCTCACCCTG
CTGAGGGATGTCCGGGAGGTGTGGGAGATGCTGGGACCCCGGATCTTCACCTTCATGAAC
GACAGTTCCAATGTGGCCATGCTGCAGCGGCTCCTGCAGATGCAGGATGAAGGAAGAAGG
CAGCCCAGACCTGGAGGCCGGGACCACATGGAGGCCCTGCGATCCTTTCTGGACCCTGGG
AGCGGTGGCTACAGCTGGCAGGACGCACACGCTGATGTGGGGCACCTGGTGGGCACGCTG
GGCCGAGTGACGGAGTGCCTGTCCTTGGACAAGCTGGAGGCGGCACCCTCAGAGGCAGCC
CTGGTGTCGCGGGCCCTGCAACTGCTCGCGGAACATCGATTCTGGGCCGGCGTCGTCTTC
TTGGGACCTGAGGACTCTTCAGACCCCACAGAGCACCCAACCCCAGACCTGGGCCCCGGC
CACGTGCGCATCAAAATCCGCATGGACATTGACGTGGTCACGAGGACCAATAAGATCAGG
GACAGGTTTTGGGACCCTGGCCCAGCCGCGGACCCCCTGACCGACCTGCGCTACGTGTGG
GGCGGCTTCGTGTACCTGCAAGACCTGGTGGAGCGTGCAGCCGTCCGCGTGCTCAGCGGC
GCCAACCCCCGGGCCGGCCTCTACCTGCAGCAGATGCCCTATCCGTGCTATGTGGACGAC
GTGTTCCTGCGTGTGCTGAGCCGGTCGCTGCCGCTCTTCCTGACGCTGGCCTGGATCTAC
TCCGTGACACTGACAGTGAAGGCCGTGGTGCGGGAGAAGGAGACGCGGCTGCGGGACACC
ATGCGCGCCATGGGGCTCAGCCGCGCGGTGCTCTGGCTAGGCTGGTTCCTCAGCTGCCTC
GGGCCCTTCCTGCTCAGCGCCGCACTGCTGGTTCTGGTGCTCAAGCTGGGAGACATCCTC
CCCTACAGCCACCCGGGCGTGGTCTTCCTGTTCTTGGCAGCCTTCGCGGTGGCCACGGTG
ACCCAGAGCTTCCTGCTCAGCGCCTTCTTCTCCCGCGCCAACCTGGCTGCGGCCTGCGGC
GGCCTGGCCTACTTCTCCCTCTACCTGCCCTACGTGCTGTGTGTGGCTTGGCGGGACCGG
CTGCCCGCGGGTGGCCGCGTGGCCGCGAGCCTGCTGTCGCCCGTGGCCTTCGGCTTCGGC
TGCGAGAGCCTGGCTCTGCTGGAGGAGCAGGGCGAGGGCGCGCAGTGGCACAACGTGGGC
ACCCGGCCTACGGCAGACGTCTTCAGCCTGGCCCAGGTCTCTGGCCTTCTGCTGCTGGAC
GCGGCGCTCTACGGCCTCGCCACCTGGTACCTGGAAGCTGTGTGCCCAGGCCAGTACGGG
ATCCCTGAACCATGGAATTTTCCTTTTCGGAGGAGCTACTGGTGCGGACCTCGGCCCCCC
AAGAGTCCAGCCCCTTGCCCCACCCCGCTGGACCCAAAGGTGCTGGTAGAAGAGGCACCG
CCCGGCCTGAGTCCTGGCGTCTCCGTTCGCAGCCTGGAGAAGCGCTTTCCTGGAAGCCCG
CAGCCAGCCCTGCGGGGGCTCAGCCTGGACTTCTACCAGGGCCACATCACCGCCTTCCTG
GGCCACAACGGGGCCGGCAAGACCACCACCCTGTCCATCTTGAGTGGCCTCTTCCCACCC
AGTGGTGGCTCTGCCTTCATCCTGGGCCACGACGTCCGCTCCAGCATGGCCGCCATCCGG
CCCCACCTGGGCGTCTGTCCTCAGTACAACGTGCTGTTTGACATGCTGACCGTGGACGAG
CACGTCTGGTTCTATGGGCGGCTGAAGGGTCTGAGTGCCGCTGTAGTGGGCCCCGAGCAG
GACCGTCTGCTGCAGGATGTGGGGCTGGTCTCCAAGCAGAGTGTGCAGACTCGCCACCTC
TCTGGTGGGATGCAACGGAAGCTGTCCGTGGCCATTGCCTTTGTGGGCGGCTCCCAAGTT
GTTATCCTGGACGAGCCTACGGCTGGCGTGGATCCTGCTTCCCGCCGCGGTATTTGGGAG
CTGCTGCTCAAATACCGAGAAGGTCGCACGCTGATCCTCTCCACCCACCACCTGGATGAG
GCAGAGCTGCTGGGAGACCGTGTGGCCGTGGTGGCAGGTGGCCGCTTGTGCTGCTGTGGC
TCCCCACTCTTCCTGCGCCGTCACCTGGGCTCCGGCTACTACCTGACGCTGGTGAAGGCC
CGCCTGCCCCTGACCACCAATGAGAAGGCTGACACTGACATGGAGGGCAGTGTGGACACC
AGGCAGGAAAAGAAGAATGGCAGCCAGGGCAGCAGAGTCGGCACTCCTCAGCTGCTGGCC
CTGGTACAGCACTGGGTGCCCGGGGCACGGCTGGTGGAGGAGCTGCCACACGAGCTGGTG
CTGGTGCTGCCCTACACGGGTGCCCATGACGGCAGCTTCGCCACACTCTTCCGAGAGCTA
GACACGCGGCTGGCGGAGCTGAGGCTCACTGGCTACGGGATCTCCGACACCAGCCTCGAG
GAGATCTTCCTGAAGGTGGTGGAGGAGTGTGCTGCGGACACAGATATGGAGGATGGCAGC
TGCGGGCAGCACCTATGCACAGGCATTGCTGGCCTAGACGTAACCCTACGGCTCAAGATG
CCGCCACAGGAGACAGCGCTGGAGAACGGGGAACCAGCTGGGTCAGCCCCAGAGACTGAC
CAGGGCTCTGGGCCAGACGCCGTGGGCCGGGTACAGGGCTGGGCACTGACCCGCCAGCAG
CTCCAGGCCCTGCTTCTCAAGCGCTTTCTGCTTGCCCGCCGCAGCCGCCGCGGCCTGTTC
GCCCAGATCGTGCTGCCTGCCCTCTTTGTGGGCCTGGCCCTCGTGTTCAGCCTCATCGTG
CCTCCTTTCGGGCACTACCCGGCTCTGCGGCTCAGTCCCACCATGTACGGTGCTCAGGTG
TCCTTCTTCAGTGAGGACGCCCCAGGGGACCCTGGACGTGCCCGGCTGCTCGAGGCGCTG
CTGCAGGAGGCAGGACTGGAGGAGCCCCCAGTGCAGCATAGCTCCCACAGGTTCTCGGCA
CCAGAAGTTCCTGCTGAAGTGGCCAAGGTCTTGGCCAGTGGCAACTGGACCCCAGAGTCT
CCATCCCCAGCCTGCCAGTGTAGCCGGCCCGGTGCCCGGCGCCTGCTGCCCGACTGCCCG
GCTGCAGCTGGTGGTCCCCCTCCGCCCCAGGCAGTGACCGGCTCTGGGGAAGTGGTTCAG
AACCTGACAGGCCGGAACCTGTCTGACTTCCTGGTCAAGACCTACCCGCGCCTGGTGCGC
CAGGGCCTGAAGACTAAGAAGTGGGTGAATGAGGTCAGATACGGAGGCTTCTCGCTGGGG
GGCCGAGACCCAGGCCTGCCCTCGGGCCAAGAGTTGGGCCGCTCAGTGGAGGAGTTGTGG
GCGCTGCTGAGTCCCCTGCCTGGCGGGGCCCTCGACCGTGTCCTGAAAAACCTCACAGCC
TGGGCTCACAGCCTGGATGCTCAGGACAGTCTCAAGATCTGGTTCAACAACAAAGGCTGG
CACTCCATGGTGGCCTTTGTCAACCGAGCCAGCAACGCAATCCTCCGTGCTCACCTGCCC
CCAGGCCCGGCCCGCCACGCCCACAGCATCACCACACTCAACCACCCCTTGAACCTCACC
AAGGAGCAGCTGTCTGAGGGTGCACTGATGGCCTCCTCGGTGGACGTCCTCGTCTCCATC
TGTGTGGTCTTTGCCATGTCCTTTGTCCCGGCCAGCTTCACTCTTGTCCTCATTGAGGAG
CGAGTCACCCGAGCCAAGCACCTGCAGCTCATGGGGGGCCTGTCCCCCACCCTCTACTGG
CTTGGCAACTTTCTCTGGGACATGTGTAACTACTTGGTGCCAGCATGCATCGTGGTGCTC
ATCTTTCTGGCCTTCCAGCAGAGGGCATATGTGGCCCCTGCCAACCTGCCTGCTCTCCTG
CTGTTGCTACTACTGTATGGCTGGTCGATCACACCGCTCATGTACCCAGCCTCCTTCTTC
TTCTCCGTGCCCAGCACAGCCTATGTGGTGCTCACCTGCATAAACCTCTTTATTGGCATC
AATGGAAGCATGGCCACCTTTGTGCTTGAGCTCTTCTCTGATCAGAAGCTGCAGGAGGTG
AGCCGGATCTTGAAACAGGTCTTCCTTATCTTCCCCCACTTCTGCTTGGGCCGGGGGCTC
ATTGACATGGTGCGGAACCAGGCCATGGCTGATGCCTTTGAGCGCTTGGGAGACAGGCAG
TTCCAGTCACCCCTGCGCTGGGAGGTGGTCGGCAAGAACCTCTTGGCCATGGTGATACAG
GGGCCCCTCTTCCTTCTCTTCACACTACTGCTGCAGCACCGAAGCCAACTCCTGCCACAG
CCCAGGGTGAGGTCTCTGCCACTCCTGGGAGAGGAGGACGAGGATGTAGCCCGTGAACGG
GAGCGGGTGGTCCAAGGAGCCACCCAGGGGGATGTGTTGGTGCTGAGGAACTTGACCAAG
GTATACCGTGGGCAGAGGATGCCAGCTGTTGACCGCTTGTGCCTGGGGATTCCCCCTGGT
GAGTGTTTTGGGCTGCTGGGTGTGAATGGAGCAGGGAAGACGTCCACGTTTCGCATGGTG
ACGGGGGACACATTGGCCAGCAGGGGCGAGGCTGTGCTGGCAGGCCACAGCGTGGCCCGG
GAACCCAGTGCTGCGCACCTCAGCATGGGATACTGCCCTCAATCCGATGCCATCTTTGAG
CTGCTGACGGGCCGCGAGCACCTGGAGCTGCTTGCGCGCCTGCGCGGTGTCCCGGAGGCC
CAGGTTGCCCAGACCGCTGGCTCGGGCCTGGCGCGTCTGGGACTCTCATGGTACGCAGAC
CGGCCTGCAGGCACCTACAGCGGAGGGAACAAACGCAAGCTGGCGACGGCCCTGGCGCTG
GTTGGGGACCCAGCCGTGGTGTTTCTGGACGAGCCGACCACAGGCATGGACCCCAGCGCG
CGGCGCTTCCTTTGGAACAGCCTTTTGGCCGTGGTGCGGGAGGGCCGTTCAGTGATGCTC
ACCTCCCATAGCATGGAGGAGTGTGAAGCGCTCTGCTCGCGCCTGGCCATCATGGTGAAT
GGGCGGTTCCGCTGCCTGGGCAGCCCGCAACATCTCAAGGGCAGATTCGCGGCGGGTCAC
ACACTGACCCTGCGGGTGCCCGCCGCAAGGTCCCAGCCGGCAGCGGCCTTCGTGGCGGCC
GAGTTCCCTGGGGCGGAGCTGCGCGAGGCACATGGAGGCCGCCTGCGCTTCCAGCTGCCG
CCGGGAGGGCGCTGCGCCCTGGCGCGCGTCTTTGGAGAGCTGGCGGTGCACGGCGCAGAG
CACGGCGTGGAGGACTTTTCCGTGAGCCAGACGATGCTGGAGGAGGTATTCTTGTACTTC
TCCAAGGACCAGGGGAAGGACGAGGACACCGAAGAGCAGAAGGAGGCAGGAGTGGGAGTG
GACCCCGCGCCAGGCCTGCAGCACCCCAAACGCGTCAGCCAGTTCCTCGATGACCCTAGC
ACTGCCGAGACTGTGCTCTGA
Protein Properties
Number of Residues 2146
Molecular Weight 234347.2
Theoretical pI 7.24
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 22-42
  • 550-570
  • 593-613
  • 626-646
  • 655-675
  • 687-707
  • 727-747
  • 849-869
  • 1243-1263
  • 1538-1558
  • 1584-1604
  • 1621-1641
  • 1649-1669
  • 1683-1703
  • 1729-1749
Protein Sequence
>ATP-binding cassette sub-family A member 7
MAFWTQLMLLLWKNFMYRRRQPVQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKP
LPSAGTVPWLQGLICNVNNTCFPQLTPGEEPGRLSNFNDSLVSRLLADARTVLGGASAHR
TLAGLGKLIATLRAARSTAQPQPTKQSPLEPPMLDVAELLTSLLRTESLGLALGQAQEPL
HSLLEAAEDLAQELLALRSLVELRALLQRPRGTSGPLELLSEALCSVRGPSSTVGPSLNW
YEASDLMELVGQEPESALPDSSLSPACSELIGALDSHPLSRLLWRRLKPLILGKLLFAPD
TPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRR
QPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHLVGTLGRVTECLSLDKLEAAPSEAA
LVSRALQLLAEHRFWAGVVFLGPEDSSDPTEHPTPDLGPGHVRIKIRMDIDVVTRTNKIR
DRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVRVLSGANPRAGLYLQQMPYPCYVDD
VFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCL
GPFLLSAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACG
GLAYFSLYLPYVLCVAWRDRLPAGGRVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVG
TRPTADVFSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPP
KSPAPCPTPLDPKVLVEEAPPGLSPGVSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFL
GHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDE
HVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQV
VILDEPTAGVDPASRRGIWELLLKYREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCG
SPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLA
LVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLE
EIFLKVVEECAADTDMEDGSCGQHLCTGIAGLDVTLRLKMPPQETALENGEPAGSAPETD
QGSGPDAVGRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIV
PPFGHYPALRLSPTMYGAQVSFFSEDAPGDPGRARLLEALLQEAGLEEPPVQHSSHRFSA
PEVPAEVAKVLASGNWTPESPSPACQCSRPGARRLLPDCPAAAGGPPPPQAVTGSGEVVQ
NLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELW
ALLSPLPGGALDRVLKNLTAWAHSLDAQDSLKIWFNNKGWHSMVAFVNRASNAILRAHLP
PGPARHAHSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEE
RVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALL
LLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELFSDQKLQEV
SRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDRQFQSPLRWEVVGKNLLAMVIQ
GPLFLLFTLLLQHRSQLLPQPRVRSLPLLGEEDEDVARERERVVQGATQGDVLVLRNLTK
VYRGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAR
EPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYAD
RPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVML
TSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQPAAAFVAA
EFPGAELREAHGGRLRFQLPPGGRCALARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYF
SKDQGKDEDTEEQKEAGVGVDPAPGLQHPKRVSQFLDDPSTAETVL
GenBank ID Protein 150417984
UniProtKB/Swiss-Prot ID Q8IZY2
UniProtKB/Swiss-Prot Entry Name ABCA7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_019112.3
GeneCard ID ABCA7
GenAtlas ID ABCA7
HGNC ID HGNC:37
References
General References
  1. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  2. Iida A, Saito S, Sekine A, Mishima C, Kitamura Y, Kondo K, Harigae S, Osawa S, Nakamura Y: Catalog of 605 single-nucleotide polymorphisms (SNPs) among 13 genes encoding human ATP-binding cassette transporters: ABCA4, ABCA7, ABCA8, ABCD1, ABCD3, ABCD4, ABCE1, ABCF1, ABCG1, ABCG2, ABCG4, ABCG5, and ABCG8. J Hum Genet. 2002;47(6):285-310. [PubMed:12111378 ]
  3. Kaminski WE, Piehler A, Schmitz G: Genomic organization of the human cholesterol-responsive ABC transporter ABCA7: tandem linkage with the minor histocompatibility antigen HA-1 gene. Biochem Biophys Res Commun. 2000 Nov 30;278(3):782-9. [PubMed:11095984 ]
  4. Kaminski WE, Orso E, Diederich W, Klucken J, Drobnik W, Schmitz G: Identification of a novel human sterol-sensitive ATP-binding cassette transporter (ABCA7). Biochem Biophys Res Commun. 2000 Jul 5;273(2):532-8. [PubMed:10873640 ]
  5. Tanaka AR, Ikeda Y, Abe-Dohmae S, Arakawa R, Sadanami K, Kidera A, Nakagawa S, Nagase T, Aoki R, Kioka N, Amachi T, Yokoyama S, Ueda K: Human ABCA1 contains a large amino-terminal extracellular domain homologous to an epitope of Sjogren's Syndrome. Biochem Biophys Res Commun. 2001 May 25;283(5):1019-25. [PubMed:11355874 ]
  6. Broccardo C, Osorio J, Luciani MF, Schriml LM, Prades C, Shulenin S, Arnould I, Naudin L, Lafargue C, Rosier M, Jordan B, Mattei MG, Dean M, Denefle P, Chimini G: Comparative analysis of the promoter structure and genomic organization of the human and mouse ABCA7 gene encoding a novel ABCA transporter. Cytogenet Cell Genet. 2001;92(3-4):264-70. [PubMed:11435699 ]
  7. Ikeda Y, Abe-Dohmae S, Munehira Y, Aoki R, Kawamoto S, Furuya A, Shitara K, Amachi T, Kioka N, Matsuo M, Yokoyama S, Ueda K: Posttranscriptional regulation of human ABCA7 and its function for the apoA-I-dependent lipid release. Biochem Biophys Res Commun. 2003 Nov 14;311(2):313-8. [PubMed:14592415 ]
  8. Wang N, Lan D, Gerbod-Giannone M, Linsel-Nitschke P, Jehle AW, Chen W, Martinez LO, Tall AR: ATP-binding cassette transporter A7 (ABCA7) binds apolipoprotein A-I and mediates cellular phospholipid but not cholesterol efflux. J Biol Chem. 2003 Oct 31;278(44):42906-12. Epub 2003 Aug 12. [PubMed:12917409 ]
  9. Kielar D, Kaminski WE, Liebisch G, Piehler A, Wenzel JJ, Mohle C, Heimerl S, Langmann T, Friedrich SO, Bottcher A, Barlage S, Drobnik W, Schmitz G: Adenosine triphosphate binding cassette (ABC) transporters are expressed and regulated during terminal keratinocyte differentiation: a potential role for ABCA7 in epidermal lipid reorganization. J Invest Dermatol. 2003 Sep;121(3):465-74. [PubMed:12925201 ]
  10. Abe-Dohmae S, Ikeda Y, Matsuo M, Hayashi M, Okuhira K, Ueda K, Yokoyama S: Human ABCA7 supports apolipoprotein-mediated release of cellular cholesterol and phospholipid to generate high density lipoprotein. J Biol Chem. 2004 Jan 2;279(1):604-11. Epub 2003 Oct 21. [PubMed:14570867 ]