Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10984
Secondary Accession Numbers
  • 17302
Name Perilipin-4
Synonyms
  1. Adipocyte protein S3-12
Gene Name PLIN4
Protein Type Unknown
Biological Properties
General Function Secondary metabolites biosynthesis, transport and catabolism
Specific Function May play a role in triacylglycerol packaging into adipocytes. May function as a coat protein involved in the biogenesis of lipid droplets
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Cytoplasm
  3. Lipid droplet
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.3
SNPs PLIN4
Gene Sequence
>4074 bp
ATGCAGACCCTGGGCAGCTTCTTTGGGTCCCTGCCTGGCTTCAGCTCTGCCCGGAACCTG
GTGGCCAACGCACATAGCTCGGCGAGAGCCCGGCCGGCCGCTGACCCCACAGGAGCGCCT
GCTGCCGAGGCTGCCCAACCACAGGCTCAGGTGGCTGCCCACCCAGAGCAGACGGCCCCA
TGGACGGAGAAGGAGCTGCAACCTTCGGAAAAGCAGATGGTGTCCGGGGCCAAAGACCTG
GTGTGTTCCAAGATGTCCAGGGCCAAGGATGCCGTGTCCTCCGGGGTGGCCAGCGTGGTG
GACGTGGCTAAGGGAGTGGTCCAGGGAGGCCTGGACACCACTCGGTCTGCACTTACGGGC
ACCAAGGAGGTGGTGTCCAGCGGGGTCACAGGGGCCATGGACATGGCTAAGGGGGCCGTC
CAAGGGGGTCTGGACACCTCGAAGGCTGTCCTCACCGGCACCAAGGACACGGTGTCCACT
GGGCTCACGGGGGCAGTGAATGTGGCCAAAGGGACCGTACAGGCCGGTGTGGACACCACC
AAGACTGTGCTGACCGGCACCAAAGACACAGTGACTACTGGGGTCATGGGGGCAGTGAAC
TTGGCCAAAGGGACTGTCCAGACTGGCGTGGAAACCTCCAAGGCTGTGCTGACCGGCACC
AAAGATGCTGTGTCCACTGGGCTCACAGGGGCAGTGAATGTGGCCAGAGGAAGCATTCAG
ACCGGTGTGGACACCAGTAAGACTGTCCTAACAGGTACCAAGGACACCGTCTGTAGTGGG
GTGACTGGTGCCATGAATGTGGCCAAAGGAACCATCCAGACCGGCGTGGACACCAGTAAG
ACTGTCCTAACAGGTACCAAGGACACCGTCTGTAGTGGGGTGACTGGTGCCATGAATGTG
GCCAAAGGAACCATCCAGACCGGCGTGGACACCAGTAAGACTGTCCTAACAGGTACCAAG
GACACCGTCTGTAGTGGGGTGACTGGTGCCATGAATGTGGCCAAAGGAACCATCCAGACC
GGCGTGGACACCACCAAGACTGTCCTAACTGGCACCAAGAACACTGTCTGCAGTGGGGTG
ACCGGTGCCGTGAACTTGGCCAAAGAGGCCATCCAGGGGGGCCTGGATACCACCAAGTCT
ATGGTCATGGGTACGAAAGACACGATGTCCACTGGGCTCACAGGGGCAGCGAATGTGGCC
AAGGGGGCCATGCAAACTGGGCTGAACACAACCCAAAATATCGCAACAGGTACAAAGGAC
ACCGTCTGCAGTGGGGTGACTGGTGCCATGAATTTGGCCAGAGGAACCATCCAGACAGGC
GTGGACACCACCAAGATCGTTCTAACTGGTACCAAGGACACTGTCTGCAGTGGGGTCACC
GGTGCTGCGAATGTGGCCAAAGGGGCCGTCCAGGGCGGCCTGGACACTACAAAGTCTGTC
CTGACTGGCACTAAAGATGCTGTGTCCACTGGGCTCACAGGGGCTGTGAACGTGGCCAAA
GGGACCGTCCAGACCGGCGTAGACACCACCAAGACTGTCCTAACCGGCACCAAGGACACC
GTCTGCAGTGGGGTGACCAGTGCTGTGAACGTGGCCAAAGGGGCCGTCCAGGGGGGCCTG
GACACCACCAAGTCTGTGGTCATAGGTACAAAAGACACGATGTCCACTGGGCTCACGGGG
GCAGCGAATGTGGCCAAGGGGGCTGTCCAGACAGGTGTAGACACAGCCAAGACCGTGCTG
ACCGGCACCAAGGACACAGTGACTACTGGGCTCGTGGGGGCAGTGAATGTCGCCAAAGGG
ACCGTCCAGACAGGCATGGACACCACCAAAACTGTCCTAACCGGTACCAAGGACACCATC
TACAGTGGGGTCACCAGTGCCGTGAACGTGGCCAAGGGGGCTGTGCAAACTGGGCTGAAA
ACGACCCAAAATATCGCGACAGGTACAAAGAACACCTTTGGCAGTGGGGTGACCAGTGCT
GTGAATGTGGCCAAAGGGGCTGCCCAGACAGGTGTAGACACGGCCAAGACCGTGCTGACC
GGCACCAAGGACACAGTCACTACTGGGCTCATGGGGGCAGTGAATGTCGCCAAAGGGACT
GTCCAGACCAGTGTGGACACCACCAAGACTGTCCTAACTGGTACCAAGGACACCGTCTGC
AGTGGGGTGACCGGTGCTGCGAATGTGGCCAAAGGGGCCATCCAAGGGGGCCTGGACACT
ACAAAGTCTGTCCTGACTGGCACTAAAGATGCTGTGTCCACTGGGCTCACAGGGGCTGTG
AAGTTGGCCAAAGGGACTGTCCAGACCGGCATGGACACCACCAAGACTGTGTTAACTGGT
ACCAAGGATGCTGTGTGCAGTGGGGTGACCGGTGCTGCGAATGTGGCCAAGGGGGCCGTC
CAGATGGGTGTAGACACGGCCAAGACCGTGCTGACCGGTACCAAGGACACTGTCTGCAGT
GGGGTCACCGGTGCTGCGAACGTGGCCAAGGGTGCTGTGCAAACTGGGCTGAAAACGACC
CAAAATATCGCAACAGGTACAAAGAACACCCTTGGCAGTGGGGTGACCGGTGCTGCGAAA
GTGGCCAAAGGGGCCGTCCAGGGGGGCCTGGACACTACAAAGTCTGTCCTGACTGGCACT
AAAGATGCCGTGTCCACTGGGCTCACAGGGGCTGTGAACTTGGCCAAAGGGACTGTCCAG
ACCGGCGTGGACACCAGCAAGACTGTCCTGACCGGTACCAAGGACACCGTCTGCAGTGGA
GTCACTGGTGCCGTAAATGTGGCCAAAGGGACCGTCCAGACAGGTGTGGACACAGCCAAG
ACGGTGCTGAGTGGCGCTAAGGATGCAGTGACTACTGGAGTCACGGGGGCAGTGAATGTG
GCCAAAGGAACCGTGCAGACCGGCGTGGACGCCTCCAAGGCTGTGCTTATGGGTACCAAG
GACACTGTCTTCAGTGGGGTTACCGGTGCCATGAGCATGGCCAAAGGGGCCGTCCAGGGG
GGCCTGGACACCACCAAGACAGTGCTGACCGGAACCAAAGACGCAGTGTCCGCTGGGCTC
ATGGGGTCAGGGAACGTGGCGACAGGGGCCACCCACACTGGCCTCAGCACCTTCCAGAAC
TGGTTACCTAGTACCCCCGCCACCTCCTGGGGTGGACTCACCAGTTCCAGGACCACAGAC
AATGGTGGGGAGCAGACTGCCCTGAGCCCCCAAGAGGCCCCGTTCTCTGGCATCTCCACG
CCCCCGGATGTGCTCAGTGTAGGCCCGGAGCCTGCCTGGGAAGCCGCAGCCACTACCAAG
GGCCTTGCGACTGACGTGGCGACGTTCACCCAAGGGGCCGCCCCAGGCAGGGAGGACACG
GGGCTTTTGGCCACCACACACGGCCCCGAAGAAGCCCCACGCTTGGCAATGCTGCAGAAT
GAGTTGGAGGGGCTGGGGGACATCTTCCACCCCATGAATGCGGAGGAGCAAGCTCAGCTG
GCTGCCTCCCAGCCTGGGCCAAAGGTGCTGTCGGCGGAACAGGGGAGCTACTTCGTTCGT
TTAGGTGACCTGGGTCCCAGCTTCCGCCAGCGGGCATTTGAACACGCGGTGAGCCACCTG
CAGCACGGCCAGTTCCAAGCCAGGGACACTCTGGCCCAGCTCCAGGACTGCTTCAGGCTG
ATTGAAAAGGCCCAGCAGGCTCCAGAAGGGCAGCCACGTCTGGACCAGGGCTCAGGTGCC
AGTGCGGAGGACGCTGCTGTCCAGGAGGAGCGGGATGCCGGGGTTCTGTCCAGGGTCTGC
GGCCTTCTCCGGCAGCTGCACACGGCCTACAGTGGCCTGGTCTCCAGCCTCCAGGGCCTG
CCCGCCGAGCTCCAGCAGCCAGTGGGGCGGGCGCGGCACAGCCTCTGTGAGCTCTATGGC
ATCGTGGCCTCAGCTGGCTCTGTAGAGGAGCTGCCCGCAGAGCGGCTGGTGCAGAGCCGC
GAGGGTGTGCACCAGGCTTGGCAGGGGTTAGAGCAGCTGCTGGAGGGCCTACAGCACAAT
CCCCCGCTCAGCTGGCTGGTAGGGCCCTTCGCCTTGCCCGCTGGCGGGCAGTAG
Protein Properties
Number of Residues 1357
Molecular Weight 134431.0
Theoretical pI 9.11
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Perilipin-4
MQTLGSFFGSLPGFSSARNLVANAHSSARARPAADPTGAPAAEAAQPQAQVAAHPEQTAP
WTEKELQPSEKQMVSGAKDLVCSKMSRAKDAVSSGVASVVDVAKGVVQGGLDTTRSALTG
TKEVVSSGVTGAMDMAKGAVQGGLDTSKAVLTGTKDTVSTGLTGAVNVAKGTVQAGVDTT
KTVLTGTKDTVTTGVMGAVNLAKGTVQTGVETSKAVLTGTKDAVSTGLTGAVNVARGSIQ
TGVDTSKTVLTGTKDTVCSGVTGAMNVAKGTIQTGVDTSKTVLTGTKDTVCSGVTGAMNV
AKGTIQTGVDTSKTVLTGTKDTVCSGVTGAMNVAKGTIQTGVDTTKTVLTGTKNTVCSGV
TGAVNLAKEAIQGGLDTTKSMVMGTKDTMSTGLTGAANVAKGAMQTGLNTTQNIATGTKD
TVCSGVTGAMNLARGTIQTGVDTTKIVLTGTKDTVCSGVTGAANVAKGAVQGGLDTTKSV
LTGTKDAVSTGLTGAVNVAKGTVQTGVDTTKTVLTGTKDTVCSGVTSAVNVAKGAVQGGL
DTTKSVVIGTKDTMSTGLTGAANVAKGAVQTGVDTAKTVLTGTKDTVTTGLVGAVNVAKG
TVQTGMDTTKTVLTGTKDTIYSGVTSAVNVAKGAVQTGLKTTQNIATGTKNTFGSGVTSA
VNVAKGAAQTGVDTAKTVLTGTKDTVTTGLMGAVNVAKGTVQTSVDTTKTVLTGTKDTVC
SGVTGAANVAKGAIQGGLDTTKSVLTGTKDAVSTGLTGAVKLAKGTVQTGMDTTKTVLTG
TKDAVCSGVTGAANVAKGAVQMGVDTAKTVLTGTKDTVCSGVTGAANVAKGAVQTGLKTT
QNIATGTKNTLGSGVTGAAKVAKGAVQGGLDTTKSVLTGTKDAVSTGLTGAVNLAKGTVQ
TGVDTSKTVLTGTKDTVCSGVTGAVNVAKGTVQTGVDTAKTVLSGAKDAVTTGVTGAVNV
AKGTVQTGVDASKAVLMGTKDTVFSGVTGAMSMAKGAVQGGLDTTKTVLTGTKDAVSAGL
MGSGNVATGATHTGLSTFQNWLPSTPATSWGGLTSSRTTDNGGEQTALSPQEAPFSGIST
PPDVLSVGPEPAWEAAATTKGLATDVATFTQGAAPGREDTGLLATTHGPEEAPRLAMLQN
ELEGLGDIFHPMNAEEQAQLAASQPGPKVLSAEQGSYFVRLGDLGPSFRQRAFEHAVSHL
QHGQFQARDTLAQLQDCFRLIEKAQQAPEGQPRLDQGSGASAEDAAVQEERDAGVLSRVC
GLLRQLHTAYSGLVSSLQGLPAELQQPVGRARHSLCELYGIVASAGSVEELPAERLVQSR
EGVHQAWQGLEQLLEGLQHNPPLSWLVGPFALPAGGQ
GenBank ID Protein 122937195
UniProtKB/Swiss-Prot ID Q96Q06
UniProtKB/Swiss-Prot Entry Name PLIN4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001080400.1
GeneCard ID PLIN4
GenAtlas ID PLIN4
HGNC ID HGNC:29393
References
General References
  1. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  2. Nagase T, Kikuno R, Ohara O: Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins. DNA Res. 2001 Aug 31;8(4):179-87. [PubMed:11572484 ]
  3. Dalen KT, Schoonjans K, Ulven SM, Weedon-Fekjaer MS, Bentzen TG, Koutnikova H, Auwerx J, Nebb HI: Adipose tissue expression of the lipid droplet-associating proteins S3-12 and perilipin is controlled by peroxisome proliferator-activated receptor-gamma. Diabetes. 2004 May;53(5):1243-52. [PubMed:15111493 ]