Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10987
Secondary Accession Numbers
  • 17305
Name Uteroglobin
Synonyms
  1. CC10
  2. CCPBP
  3. Clara cell phospholipid-binding protein
  4. Clara cells 10 kDa secretory protein
  5. Secretoglobin family 1A member 1
  6. UP-1
  7. UP1
  8. Urinary protein 1
  9. Urine protein 1
Gene Name SCGB1A1
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
binding
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 11q12.3-q13.1
SNPs SCGB1A1
Gene Sequence
>276 bp
ATGAAACTCGCTGTCACCCTCACCCTGGTCACACTGGCTCTCTGCTGCAGCTCCGCTTCT
GCAGAGATCTGCCCGAGCTTTCAGCGTGTCATCGAAACCCTCCTCATGGACACACCCTCC
AGTTATGAGGCTGCCATGGAACTTTTCAGCCCTGATCAAGACATGAGGGAGGCAGGGGCT
CAGCTGAAGAAGCTGGTGGACACCCTCCCCCAAAAGCCCAGAGAAAGCATCATTAAGCTC
ATGGAAAAAATAGCCCAAAGCTCACTGTGTAATTAG
Protein Properties
Number of Residues 91
Molecular Weight 9993.6
Theoretical pI 4.71
Pfam Domain Function
Signals
  • 1-21
Transmembrane Regions
  • None
Protein Sequence
>Uteroglobin
MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGA
QLKKLVDTLPQKPRESIIKLMEKIAQSSLCN
GenBank ID Protein 189053293
UniProtKB/Swiss-Prot ID P11684
UniProtKB/Swiss-Prot Entry Name UTER_HUMAN
PDB IDs Not Available
GenBank Gene ID AK312165
GeneCard ID SCGB1A1
GenAtlas ID SCGB1A1
HGNC ID HGNC:12523
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Singh G, Katyal SL, Brown WE, Phillips S, Kennedy AL, Anthony J, Squeglia N: Amino-acid and cDNA nucleotide sequences of human Clara cell 10 kDa protein. Biochim Biophys Acta. 1988 Sep 7;950(3):329-37. [PubMed:3167058 ]
  4. Hay JG, Danel C, Chu CS, Crystal RG: Human CC10 gene expression in airway epithelium and subchromosomal locus suggest linkage to airway disease. Am J Physiol. 1995 Apr;268(4 Pt 1):L565-75. [PubMed:7733299 ]
  5. Wolf M, Klug J, Hackenberg R, Gessler M, Grzeschik KH, Beato M, Suske G: Human CC10, the homologue of rabbit uteroglobin: genomic cloning, chromosomal localization and expression in endometrial cell lines. Hum Mol Genet. 1992 Sep;1(6):371-8. [PubMed:1284526 ]
  6. Okutani R, Itoh Y, Hirata H, Kasahara T, Mukaida N, Kawai T: Simple and high-yield purification of urine protein 1 using immunoaffinity chromatography: evidence for the identity of urine protein 1 and human Clara cell 10-kilodalton protein. J Chromatogr. 1992 May 20;577(1):25-35. [PubMed:1400743 ]
  7. Bernard A, Roels H, Lauwerys R, Witters R, Gielens C, Soumillion A, Van Damme J, De Ley M: Human urinary protein 1: evidence for identity with the Clara cell protein and occurrence in respiratory tract and urogenital secretions. Clin Chim Acta. 1992 May 15;207(3):239-49. [PubMed:1395029 ]
  8. Ghafouri B, Stahlbom B, Tagesson C, Lindahl M: Newly identified proteins in human nasal lavage fluid from non-smokers and smokers using two-dimensional gel electrophoresis and peptide mass fingerprinting. Proteomics. 2002 Jan;2(1):112-20. [PubMed:11788998 ]
  9. Umland TC, Swaminathan S, Singh G, Warty V, Furey W, Pletcher J, Sax M: Structure of a human Clara cell phospholipid-binding protein-ligand complex at 1.9 A resolution. Nat Struct Biol. 1994 Aug;1(8):538-45. [PubMed:7664082 ]