Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10990
Secondary Accession Numbers
  • 17310
Name Serine incorporator 5
Synonyms Not Available
Gene Name SERINC5
Protein Type Unknown
Biological Properties
General Function Involved in phosphatidylserine metabolic process
Specific Function Enhances the incorporation of serine into phosphatidylserine and sphingolipids. May play a role in providing serine molecules for the formation of myelin glycosphingolipids in oligodendrocytes
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5q14.1
SNPs SERINC5
Gene Sequence
>1272 bp
ATGTCAGCTCAGTGCTGTGCGGGCCAGCTGGCCTGCTGCTGTGGGTCTGCAGGCTGCTCT
CTCTGCTGTGATTGCTGCCCCAGGATTCGGCAGTCCCTCAGCACCCGCTTCATGTACGCC
CTCTACTTCATTCTGGTCGTCGTCCTCTGCTGCATCATGATGTCAACAACCGTGGCTCAC
AAGATGAAAGAGCACATTCCTTTTTTTGAAGATATGTGTAAAGGCATTAAAGCTGGTGAC
ACCTGTGAGAAGCTGGTGGGATATTCTGCCGTGTATAGAGTCTGTTTTGGAATGGCTTGT
TTCTTCTTTATCTTCTGTCTACTGACCTTGAAAATCAACAACAGCAAAAGTTGTAGAGCT
CATATTCACAATGGCTTTTGGTTCTTTAAACTTCTGCTGTTGGGGGCCATGTGCTCAGGA
GCTTTCTTCATTCCAGATCAGGACACCTTTCTGAACGCCTGGCGCTATGTGGGAGCCGTC
GGAGGCTTCCTCTTCATTGGCATCCAGCTCCTCCTGCTCGTGGAGTTTGCACATAAGTGG
AACAAGAACTGGACAGCAGGCACAGCCAGTAACAAGCTGTGGTACGCCTCCCTGGCCCTG
GTGACGCTCATCATGTATTCCATTGCCACTGGAGGCTTGGTTTTGATGGCAGTGTTTTAT
ACACAGAAAGACAGCTGCATGGAAAACAAAATTCTGCTGGGAGTAAATGGAGGCCTGTGC
CTGCTTATATCATTGGTAGCCATCTCACCCTGGGTCCAAAATCGACAGCCACACTCGGGG
CTCTTACAATCAGGGGTCATAAGCTGCTATGTCACCTACCTCACCTTCTCAGCTCTGTCC
AGCAAACCTGCAGAAGTAGTTCTAGATGAACATGGGAAAAATGTTACAATCTGTGTGCCT
GACTTTGGTCAAGACCTGTACAGAGATGAAAACTTGGTGACTATACTGGGGACCAGCCTC
TTAATCGGATGTATCTTGTATTCATGTTTGACATCAACAACAAGATCGAGTTCTGACGCT
CTGCAGGGGCGATACGCAGCTCCTGAATTGGAGATAGCTCGCTGTTGTTTTTGCTTCAGT
CCTGGTGGAGAGGACACTGAAGAGCAGCAGCCGGGGAAGGAGGGACCACGGGTCATTTAT
GACGAGAAGAAAGGCACCGTCTACATCTACTCCTACTTCCACTTCGTGTTCTTCCTAGCT
TCCCTGTATGTGATGATGACCGTCACCAACTGGTTCAACCATGTAAGAAGTGCCTTTCAC
CTCCTGCCATGA
Protein Properties
Number of Residues 423
Molecular Weight 47008.7
Theoretical pI 7.65
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 37-57
  • 90-110
  • 125-145
  • 157-177
  • 199-219
  • 231-251
  • 259-279
  • 312-332
  • 386-406
Protein Sequence
>Serine incorporator 5
MSAQCCAGQLACCCGSAGCSLCCDCCPRIRQSLSTRFMYALYFILVVVLCCIMMSTTVAH
KMKEHIPFFEDMCKGIKAGDTCEKLVGYSAVYRVCFGMACFFFIFCLLTLKINNSKSCRA
HIHNGFWFFKLLLLGAMCSGAFFIPDQDTFLNAWRYVGAVGGFLFIGIQLLLLVEFAHKW
NKNWTAGTASNKLWYASLALVTLIMYSIATGGLVLMAVFYTQKDSCMENKILLGVNGGLC
LLISLVAISPWVQNRQPHSGLLQSGVISCYVTYLTFSALSSKPAEVVLDEHGKNVTICVP
DFGQDLYRDENLVTILGTSLLIGCILYSCLTSTTRSSSDALQGRYAAPELEIARCCFCFS
PGGEDTEEQQPGKEGPRVIYDEKKGTVYIYSYFHFVFFLASLYVMMTVTNWFNHVRSAFH
LLP
GenBank ID Protein 29893239
UniProtKB/Swiss-Prot ID Q86VE9
UniProtKB/Swiss-Prot Entry Name SERC5_HUMAN
PDB IDs Not Available
GenBank Gene ID AF498273
GeneCard ID SERINC5
GenAtlas ID SERINC5
HGNC ID HGNC:18825
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Xu J, Ji C, Wang L, Cao Y, Dai J, Ye X, Zeng L, Dai J, Wu Q, Xie Y, Mao Y: Cloning and expression of a novel human C5orf12 gene*, a member of the TMS_TDE family. Mol Biol Rep. 2003 Mar;30(1):47-52. [PubMed:12688535 ]