Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11001
Secondary Accession Numbers
  • 17325
Name Cytosolic acyl coenzyme A thioester hydrolase-like
Synonyms
  1. Acyl-CoA thioesterase 7-like
Gene Name ACOT7L
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH (By similarity).
Pathways Not Available
Reactions
hexadecanoyl-CoA + Water → Coenzyme A + Palmitic acid details
GO Classification
Cellular Component
cytoplasm
Molecular Function
carboxylesterase activity
palmitoyl-CoA hydrolase activity
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs ACOT7L
Gene Sequence
>759 bp
ATGATCAAAGAGGCGGGCGCCATCATCAGCACCCGGCATTGCAATCCGCAGAACGGGGAT
CGCTGTGTGGCCGCTCTGGCTCGGGTCGAGTGCACCCACTTCCTGTGGCCCATGTGCATC
GGTGAGGTGGCCCACGTCAGCGCGGAGATCACCTACACCTCCAAGCACTCTGTGGAGGTG
CAGGTCAACATGATGTCCGAAAACATCCTCACAGGTGCCAAAAAGCTGACCAATAAGGCC
ACCCTCTGGTATGCGCCCCTGTCGCTGACGAACGTGGACAAGGTCCTCGAAGAGCCTCCT
GTTGTGTATTTCCGGCAGGAGCAGGAGGAGGAGGGCCAGAAGCGGTACAAAACCCAGAAG
CTGGAGCGCATGGAGACCAACTGGAGGAACGGGGACATCGTCCAGCCAGTCCTCAACCCA
GAGCCGAACACTGTCAGCTACAGCCAGTCCAGCTTGATCCACCTGGTGGGGCCTTCAGAC
TGTACCCTGCACAGCTTCGTGCATGAAGGGGTGACCATGAAGGTCATGGACGAGGTCGCC
GGGATCTTGGCTGCACGCCACTGCAAGACCAACCTCGTCACAGCCTCCATGGAGGCCATT
AATTTTGACAACAAGATCAGAAAAGGCTGCATCAAGACCATCTCCGGACGCATGACCTTC
ACGAGCAATAAGTCCGTAGAGATCGAGGTCTTGGTGGATGCCGACTGTGTTGTGGACAGC
TCTCAGAAGCGCTACAGGGCCGCCAGTGTCTTCACCTAA
Protein Properties
Number of Residues 252
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytosolic acyl coenzyme A thioester hydrolase-like
MIKEAGAIISTRHCNPQNGDRCVAALARVECTHFLWPMCIGEVAHVSAEITYTSKHSVEV
QVNMMSENILTGAKKLTNKATLWYAPLSLTNVDKVLEEPPVVYFRQEQEEEGQKRYKTQK
LERMETNWRNGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHSFVHEGVTMKVMDEVA
GILAARHCKTNLVTASMEAINFDNKIRKGCIKTISGRMTFTSNKSVEIEVLVDADCVVDS
SQKRYRAASVFT
GenBank ID Protein 34531349
UniProtKB/Swiss-Prot ID Q6ZUV0
UniProtKB/Swiss-Prot Entry Name BACHL_HUMAN
PDB IDs Not Available
GenBank Gene ID AK125299
GeneCard ID ACOT7L
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Jiang RC, Qin HD, Zeng MS, Huang W, Feng BJ, Zhang F, Chen HK, Jia WH, Chen LZ, Feng QS, Zhang RH, Yu XJ, Zheng MZ, Zeng YX: A functional variant in the transcriptional regulatory region of gene LOC344967 cosegregates with disease phenotype in familial nasopharyngeal carcinoma. Cancer Res. 2006 Jan 15;66(2):693-700. [PubMed:16423998 ]