Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11002
Secondary Accession Numbers
  • 17326
Name Acyl-CoA synthetase family member 2, mitochondrial
Synonyms Not Available
Gene Name ACSF2
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Has some preference toward medium-chain substrates. Plays a role in adipodyte differentiation
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
Process
metabolic process
Cellular Location
  1. Mitochondrion (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 17q21.33
SNPs ACSF2
Gene Sequence
>1848 bp
ATGGCTGTCTACGTCGGGATGCTGCGCCTGGGGAGGCTGTGCGCCGGGAGCTCGGGGGTG
CTGGGGGCCCGGGCCGCCCTCTCTCGGAGTTGGCAGGAAGCCAGGTTGCAGGGTGTCCGC
TTCCTCAGTTCCAGAGAGGTGGATCGCATGGTCTCCACGCCCATCGGAGGCCTCAGCTAC
GTTCAGGGGTGCACCAAAAAGCATCTTAACAGCAAGACTGTGGGCCAGTGCCTGGAGACC
ACAGCACAGAGGGTCCCAGAACGAGAGGCCTTGGTCGTCCTCCATGAAGACGTCAGGTTG
ACCTTTGCCCAACTCAAGGAGGAGGTGGACAAAGCTGCTTCTGGCCTCCTGAGCATTGGC
CTCTGCAAAGGTGACCGGCTGGGCATGTGGGGACCTAACTCCTATGCATGGGTGCTCATG
CAGTTGGCCACCGCCCAGGCGGGCATCATTCTGGTGTCTGTGAACCCAGCCTACCAGGCT
ATGGAACTGGAGTATGTCCTCAAGAAGGTGGGCTGCAAGGCCCTTGTGTTCCCCAAGCAA
TTCAAGACCCAGCAATACTACAACGTCCTGAAGCAGATCTGTCCAGAAGTGGAGAATGCC
CAGCCAGGGGCCTTGAAGAGTCAGAGGCTCCCAGATCTGACCACAGTCATCTCGGTGGAT
GCCCCTTTGCCGGGGACCCTGCTCCTGGATGAAGTGGTGGCGGCTGGCAGCACACGGCAG
CATCTGGACCAGCTCCAATACAACCAGCAGTTCCTGTCCTGCCATGACCCCATCAACATC
CAGTTCACCTCGGGGACAACAGGCAGCCCCAAGGGGGCCACCCTCTCCCACTACAACATT
GTCAACAACTCCAACATTTTAGGAGAGCGCCTGAAACTGCATGAGAAGACACCAGAGCAG
TTGCGGATGATCCTGCCCAACCCCCTGTACCATTGCCTGGGTTCCGTGGCAGGCACAATG
ATGTGTCTGATGTACGGTGCCACCCTCATCCTGGCCTCTCCCATCTTCAATGGCAAGAAG
GCACTGGAGGCCATCAGCAGAGAGAGAGGCACCTTCCTGTATGGTACCCCCACGATGTTC
GTGGACATTCTGAACCAGCCAGACTTCTCCAGTTATGACATCTCGACCATGTGTGGAGGT
GTCATTGCTGGGTCCCCTGCACCTCCAGAGTTGATCCGAGCCATCATCAACAAGATAAAT
ATGAAGGACCTGGTGGTTGCTTATGGAACCACAGAGAACAGTCCCGTGACATTCGCGCAC
TTCCCTGAGGACACTGTGGAGCAGAAGGCAGAAAGCGTGGGCAGAATTATGCCTCACACG
GAGGCCCGGATCATGAACATGGAGGCAGGGACGCTGGCAAAGCTGAACACGCCCGGGGAG
CTGTGCATCCGAGGGTACTGCGTCATGCTGGGCTACTGGGGTGAGCCTCAGAAGACAGAG
GAAGCAGTGGATCAGGACAAGTGGTATTGGACAGGAGATGTCGCCACAATGAATGAGCAG
GGCTTCTGCAAGATCGTGGGCCGCTCTAAGGATATGATCATCCGGGGTGGTGAGAACATC
TACCCCGCAGAGCTCGAGGACTTCTTTCACACACACCCGAAGGTGCAGGAAGTGCAGGTG
GTGGGAGTGAAGGACGATCGGATGGGGGAAGAGATTTGTGCCTGCATTCGGCTGAAGGAC
GGGGAGGAGACCACGGTGGAGGAGATAAAAGCTTTCTGCAAAGGGAAGATCTCTCACTTC
AAGATTCCGAAGTACATCGTGTTTGTCACAAACTACCCCCTCACCATTTCAGGAAAGATC
CAGAAATTCAAACTTCGAGAGCAGATGGAACGACATCTAAATCTGTGA
Protein Properties
Number of Residues 615
Molecular Weight 68124.4
Theoretical pI 7.6
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Acyl-CoA synthetase family member 2, mitochondrial
MAVYVGMLRLGRLCAGSSGVLGARAALSRSWQEARLQGVRFLSSREVDRMVSTPIGGLSY
VQGCTKKHLNSKTVGQCLETTAQRVPEREALVVLHEDVRLTFAQLKEEVDKAASGLLSIG
LCKGDRLGMWGPNSYAWVLMQLATAQAGIILVSVNPAYQAMELEYVLKKVGCKALVFPKQ
FKTQQYYNVLKQICPEVENAQPGALKSQRLPDLTTVISVDAPLPGTLLLDEVVAAGSTRQ
HLDQLQYNQQFLSCHDPINIQFTSGTTGSPKGATLSHYNIVNNSNILGERLKLHEKTPEQ
LRMILPNPLYHCLGSVAGTMMCLMYGATLILASPIFNGKKALEAISRERGTFLYGTPTMF
VDILNQPDFSSYDISTMCGGVIAGSPAPPELIRAIINKINMKDLVVAYGTTENSPVTFAH
FPEDTVEQKAESVGRIMPHTEARIMNMEAGTLAKLNTPGELCIRGYCVMLGYWGEPQKTE
EAVDQDKWYWTGDVATMNEQGFCKIVGRSKDMIIRGGENIYPAELEDFFHTHPKVQEVQV
VGVKDDRMGEEICACIRLKDGEETTVEEIKAFCKGKISHFKIPKYIVFVTNYPLTISGKI
QKFKLREQMERHLNL
GenBank ID Protein 10436885
UniProtKB/Swiss-Prot ID Q96CM8
UniProtKB/Swiss-Prot Entry Name ACSF2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK024573
GeneCard ID ACSF2
GenAtlas ID ACSF2
HGNC ID HGNC:26101
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  5. Watkins PA, Maiguel D, Jia Z, Pevsner J: Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome. J Lipid Res. 2007 Dec;48(12):2736-50. Epub 2007 Aug 30. [PubMed:17762044 ]
  6. Perera RJ, Marcusson EG, Koo S, Kang X, Kim Y, White N, Dean NM: Identification of novel PPARgamma target genes in primary human adipocytes. Gene. 2006 Mar 15;369:90-9. Epub 2005 Dec 27. [PubMed:16380219 ]