Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11003
Secondary Accession Numbers
  • 17327
Name Acyl-coenzyme A thioesterase 11
Synonyms
  1. Acyl-CoA thioester hydrolase 11
  2. Acyl-CoA thioesterase 11
  3. Adipose-associated thioesterase
  4. BFIT
  5. Brown fat-inducible thioesterase
Gene Name ACOT11
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Has acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1p32.3
SNPs ACOT11
Gene Sequence
>1824 bp
ATGATCCAGAATGTCGGAAATCACCTGCGACGGGGCTTGGCCTCTGTGTTCTCCAACCGC
ACATCCCGGAAGTCAGCCTTACGTGCGGGGAACGACAGTGCCATGGCAGACGGCGAGGGA
TACCGGAACCCCACGGAGGTGCAGATGAGCCAGCTGGTGCTGCCCTGCCACACCAACCAA
CGTGGTGAGCTGAGCGTCGGGCAGCTGCTCAAGTGGATTGACACCACGGCTTGCCTGTCC
GCGGAGAGGCACGCTGGCTGCCCCTGTGTCACAGCTTCCATGGATGACATCTATTTTGAG
CACACCATTAGTGTTGGACAAGTGGTGAATATCAAGGCCAAGGTGAACCGGGCCTTCAAC
TCCAGCATGGAGGTGGGCATCCAGGTGGCCTCGGAGGACCTGTGCTCTGAGAAGCAGTGG
AATGTGTGCAAGGCCTTGGCCACCTTCGTGGCCCGCCGAGAGATCACCAAGGTGAAGCTG
AAGCAGATCACGCCGCGGACAGAAGAGGAGAAGATGGAGCACAGTGTGGCGGCTGAGCGC
CGGCGCATGCGCCTTGTCTATGCAGACACCATCAAGGACCTCCTGGCCAACTGCGCCATT
CAGGGCGATCTGGAGAGCAGAGACTGTAGCCGCATGGTGCCGGCTGAGAAGACCCGTGTG
GAGAGTGTGGAGCTGGTCCTGCCTCCCCACGCCAATCACCAGGGCAACACCTTTGGGGGC
CAGATCATGGCCTGGATGGAGAATGTGGCCACCATTGCAGCCAGCCGGCTCTGCCGTGCC
CACCCTACGCTGAAGGCCATTGAAATGTTCCACTTCCGAGGCCCGTCCCAGGTCGGCGAC
CGTCTGGTGCTCAAAGCCATCGTGAACAATGCCTTCAAACATAGCATGGAGGTGGGCGTG
TGCGTGGAGGCCTATCGCCAGGAGGCTGAGACCCACCGGCGCCACATCAACAGTGCCTTT
ATGACCTTTGTGGTCCTGGACGCAGATGACCAGCCCCAGTTGCTGCCCTGGATTCGGCCC
CAGCCCGGCGATGGTGAGCGGCGGTACCGAGAGGCCAGTGCCAGAAAGAAGATCCGCCTG
GACAGGAAGTACATCGTGTCCTGTAAGCAGACAGAGGTGCCCCTCTCCGTCCCCTGGGAC
CCTAGCAACCAGGTGTACCTGAGCTACAATAACGTCTCCTCCTTGAAGATGCTTGTGGCC
AAGGACAACTGGGTGCTGTCCTCGGAGATCAGTCAGGTCCGCCTGTACACTCTGGAGGAT
GACAAGTTCCTCTCCTTCCACATGGAGATGGTGGTGCATGTGGATGCAGCCCAGGCCTTC
CTGCTGCTCTCGGACCTGCGTCAGAGGCCAGAGTGGGACAAGCACTACCGGAGCGTGGAG
CTAGTGCAGCAGGTAGACGAGGACGACGCCATCTACCACGTCACCAGCCCTGCCCTCGGA
GGTCACACAAAGCCCCAGGACTTCGTGATCCTGGCCTCGAGGCGGAAGCCTTGTGACAAT
GGGGACCCCTATGTCATCGCGCTGAGGTCGGTCACGCTGCCCACACACCGAGAGACGCCA
GAGTACAGACGCGGAGAGACCCTCTGCTCAGGCTTCTGCCTCTGGCGCGAGGGGGACCAG
CTGACCAAGTGCTGCTGGGTTAGGGTCTCCCTGACTGAGCTGGTCTCGGCAAGTGGCTTC
TATTCCTGGGGGCTCGAATCCAGGTCAAAGGGTCGCAGGAGCGACGGTTGGAATGGAAAA
CTAGCTGGAGGACACCTGAGTACTCTTAAAGCAATCCCCGTGGCCAAAATCAACAGCCGA
TTTGGATACCTTCAAGACACCTGA
Protein Properties
Number of Residues 607
Molecular Weight 68491.6
Theoretical pI 8.43
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Acyl-coenzyme A thioesterase 11
MIQNVGNHLRRGLASVFSNRTSRKSALRAGNDSAMADGEGYRNPTEVQMSQLVLPCHTNQ
RGELSVGQLLKWIDTTACLSAERHAGCPCVTASMDDIYFEHTISVGQVVNIKAKVNRAFN
SSMEVGIQVASEDLCSEKQWNVCKALATFVARREITKVKLKQITPRTEEEKMEHSVAAER
RRMRLVYADTIKDLLANCAIQGDLESRDCSRMVPAEKTRVESVELVLPPHANHQGNTFGG
QIMAWMENVATIAASRLCRAHPTLKAIEMFHFRGPSQVGDRLVLKAIVNNAFKHSMEVGV
CVEAYRQEAETHRRHINSAFMTFVVLDADDQPQLLPWIRPQPGDGERRYREASARKKIRL
DRKYIVSCKQTEVPLSVPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLYTLED
DKFLSFHMEMVVHVDAAQAFLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALG
GHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQ
LTKCCWVRVSLTELVSASGFYSWGLESRSKGRRSDGWNGKLAGGHLSTLKAIPVAKINSR
FGYLQDT
GenBank ID Protein 22165355
UniProtKB/Swiss-Prot ID Q8WXI4
UniProtKB/Swiss-Prot Entry Name ACO11_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015547.3
GeneCard ID ACOT11
GenAtlas ID ACOT11
HGNC ID HGNC:18156
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Tang LY, Deng N, Wang LS, Dai J, Wang ZL, Jiang XS, Li SJ, Li L, Sheng QH, Wu DQ, Li L, Zeng R: Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction. Mol Cell Proteomics. 2007 Nov;6(11):1952-67. Epub 2007 Aug 12. [PubMed:17693683 ]
  5. Ishikawa K, Nagase T, Suyama M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Jun 30;5(3):169-76. [PubMed:9734811 ]
  6. Adams SH, Chui C, Schilbach SL, Yu XX, Goddard AD, Grimaldi JC, Lee J, Dowd P, Colman S, Lewin DA: BFIT, a unique acyl-CoA thioesterase induced in thermogenic brown adipose tissue: cloning, organization of the human gene and assessment of a potential link to obesity. Biochem J. 2001 Nov 15;360(Pt 1):135-42. [PubMed:11696000 ]