Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11005
Secondary Accession Numbers
  • 17329
Name Long-chain-fatty-acid--CoA ligase ACSBG1
Synonyms
  1. Acyl-CoA synthetase bubblegum family member 1
  2. Lipodisin
  3. hBG1
  4. hsBG
  5. hsBGM
  6. Lipidosin
Gene Name ACSBG1
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids; however, the relevance of such activity is unclear in vivo. Can activate diverse saturated, monosaturated and polyunsaturated fatty acids.
Pathways
  • Adipocytokine signaling pathway
  • fatty acid metabolism
  • PPAR signaling pathway
Reactions
Adenosine triphosphate + a long-chain fatty acid + Coenzyme A → Adenosine monophosphate + Pyrophosphate + an acyl-CoA details
Adenosine triphosphate + Palmitic acid + Coenzyme A → Adenosine monophosphate + Palmityl-CoA + Pyrophosphate details
GO Classification
Biological Process
myelination
ovarian follicle atresia
very long-chain fatty acid metabolic process
response to glucocorticoid stimulus
Cellular Component
cytoplasm
endoplasmic reticulum
cytoplasmic membrane-bounded vesicle
Function
catalytic activity
Molecular Function
ATP binding
long-chain fatty acid-CoA ligase activity
very long-chain fatty acid-CoA ligase activity
Process
metabolic process
Cellular Location
  1. Cytoplasm
  2. Cytoplasmic vesicle
  3. Microsome
  4. Endoplasmic reticulum
Gene Properties
Chromosome Location 15
Locus 15q23-q24
SNPs ACSBG1
Gene Sequence
>2175 bp
ATGCCACGCAATTCTGGAGCTGGATACGGCTGCCCACACGGGGACCCCAGCATGCTGGAC
AGCAGAGAGACCCCACAGGAGAGCCGGCAGGACATGATTGTGAGGACCACCCAAGAAAAA
TTGAAAACCAGCTCACTGACTGACAGGCAGCCACTCTCCAAAGAGTCCCTGAACCATGCT
CTCGAGCTCTCAGTGCCAGAGAAGGTGAATAATGCCCAGTGGGATGCTCCAGAGGAGGCG
CTGTGGACGACTCGGGCCGATGGGCGGGTGCGCCTGCGCATAGACCCCAGCTGCCCACAG
CTTCCCTACACTGTGCATCGGATGTTCTACGAGGCCCTGGATAAGTATGGGGACCTCATC
GCTTTGGGCTTCAAGCGCCAGGACAAGTGGGAACACATCTCCTACTCCCAATACTACCTG
CTCGCCCGCAGAGCCGCCAAGGGCTTCCTGAAGCTCGGCCTGAAGCAGGCCCACAGTGTG
GCCATCCTCGGCTTCAACTCCCCGGAGTGGTTCTTCTCGGCAGTGGGCACAGTATTTGCA
GGTGGCATCGTCACTGGCATCTACACCACCAGCTCCCCAGAGGCCTGCCAGTACATCGCT
TATGACTGCTGCGCCAATGTCATCATGGTCGACACGCAGAAGCAGCTGGAAAAGATCCTG
AAGATCTGGAAACAGTTGCCACATCTAAAGGCAGTCGTGATATATAAAGAACCTCCTCCA
AACAAGATGGCCAATGTGTACACGATGGAGGAATTCATGGAGCTGGGGAATGAAGTGCCT
GAGGAAGCCCTGGACGCCATCATTGACACCCAGCAGCCCAACCAGTGCTGTGTGCTAGTC
TACACTTCCGGCACCACTGGGAACCCCAAGGGCGTGATGCTGAGTCAAGACAATATCACG
TGGACGGCACGGTACGGCAGCCAGGCCGGTGACATCCGGCCGGCAGAAGTCCAGCAGGAG
GTGGTAGTCAGCTACCTGCCCCTCAGCCATATTGCCGCCCAGATCTACGACCTGTGGACA
GGCATCCAGTGGGGGGCCCAGGTTTGCTTTGCCGAACCCGACGCCCTGAAGGGGAGCCTG
GTGAACACGCTGCGGGAGGTGGAGCCCACATCACACATGGGGGTGCCCCGGGTATGGGAG
AAGATCATGGAGCGCATCCAGGAGGTGGCGGCTCAGTCTGGCTTCATCCGGCGAAAGATG
CTGCTGTGGGCCATGTCGGTGACCTTGGAGCAGAACCTCACCTGCCCCGGCAGCGACCTG
AAGCCCTTCACAACCAGACTGGCAGATTACCTGGTGCTAGCCAAGGTTCGCCAGGCACTG
GGATTTGCCAAGTGTCAAAAGAACTTCTATGGAGCGGCCCCCATGATGGCAGAGACACAG
CACTTCTTCCTGGGTCTCAACATCCGCTTGTATGCGGGCTACGGCCTCAGTGAGACCTCA
GGCCCCCACTTCATGTCCAGTCCCTACAACTACCGGCTGTACAGCTCAGGCAAGTTGGTG
CCCGGCTGTCGGGTGAAGCTGGTGAACCAGGACGCAGAGGGCATTGGCGAGATCTGCCTG
TGGGGCCGCACCATATTCATGGGCTACCTGAACATGGAGGACAAGACTTGTGAGGCCATC
GACGAGGAAGGCTGGCTGCACACGGGTGATGCTGGCCGCCTGGACGCCGATGGCTTCCTC
TACATCACTGGGCGCCTCAAAGAATTAATCATCACAGCTGGTGGGGAGAATGTGCCCCCT
GTGCCCATCGAGGAGGCCGTGAAGATGGAGCTGCCCATCATCAGCAACGCCATGCTCATT
GGGGACCAGAGGAAGTTCCTGTCCATGCTGCTCACCTTGAAGTGCACTCTGGACCCAGAC
ACCTCTGACCAGACTGATAATCTGACTGAACAAGCTATGGAGTTCTGCCAGAGGGTGGGC
AGCAGAGCCACCACAGTGTCCGAGATCATAGAGAAGAAGGATGAGGCCGTGTACCAGGCC
ATCGAAGAGGGGATCCGGAGGGTCAACATGAACGCGGCGGCCCGGCCCTACCACATCCAG
AAGTGGGCCATTCTCGAGAGAGACTTCTCCATTTCGGGTGGAGAGTTGGGTCCCACGATG
AAACTGAAACGGCTCACAGTTTTGGAGAAGTACAAAGGTATCATTGACTCCTTTTACCAA
GAGCAAAAAATGTAA
Protein Properties
Number of Residues 724
Molecular Weight 80878.065
Theoretical pI 5.92
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Long-chain-fatty-acid--CoA ligase ACSBG1
MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHA
LELSVPEKVNNAQWDAPEEALWTTRADGRVRLRIDPSCPQLPYTVHRMFYEALDKYGDLI
ALGFKRQDKWEHISYSQYYLLARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAVGTVFA
GGIVTGIYTTSSPEACQYIAYDCCANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPP
NKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNIT
WTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSL
VNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDL
KPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETS
GPHFMSSPYNYRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAI
DEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLI
GDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAMEFCQRVGSRATTVSEIIEKKDEAVYQA
IEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTMKLKRLTVLEKYKGIIDSFYQ
EQKM
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96GR2
UniProtKB/Swiss-Prot Entry Name ACBG1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF179481
GeneCard ID ACSBG1
GenAtlas ID ACSBG1
HGNC ID HGNC:29567
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  4. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  5. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]
  6. Ishikawa K, Nagase T, Suyama M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Jun 30;5(3):169-76. [PubMed:9734811 ]
  7. Steinberg SJ, Morgenthaler J, Heinzer AK, Smith KD, Watkins PA: Very long-chain acyl-CoA synthetases. Human "bubblegum" represents a new family of proteins capable of activating very long-chain fatty acids. J Biol Chem. 2000 Nov 10;275(45):35162-9. [PubMed:10954726 ]
  8. Pei Z, Oey NA, Zuidervaart MM, Jia Z, Li Y, Steinberg SJ, Smith KD, Watkins PA: The acyl-CoA synthetase "bubblegum" (lipidosin): further characterization and role in neuronal fatty acid beta-oxidation.. J Biol Chem. 2003 Nov 21;278(47):47070-8. Epub 2003 Sep 15. [PubMed:12975357 ]