Hmdb loader

Showing Protein Fatty acid-binding protein, intestinal (HMDBP11385)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 32 metabolites
Identification
HMDB Protein ID HMDBP11385
Secondary Accession Numbers
  • 17718
Name Fatty acid-binding protein, intestinal
Synonyms
  1. Fatty acid-binding protein 2
  2. I-FABP
  3. Intestinal-type fatty acid-binding protein
Gene Name FABP2
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long- chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
transporter activity
lipid binding
Process
establishment of localization
transport
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:4
Locus 4q28-q31
SNPs FABP2
Gene Sequence 
>399 bp
ATGGCGTTTGACAGCACTTGGAAGGTAGACCGGAGTGAAAACTATGACAAGTTCATGGAA
AAAATGGGTGTTAATATAGTGAAAAGGAAGCTTGCAGCTCATGACAATTTGAAGCTGACA
ATTACACAAGAAGGAAATAAATTCACAGTCAAAGAATCAAGCGCTTTTCGAAACATTGAA
GTTGTTTTTGAACTTGGTGTCACCTTTAATTACAATCTAGCAGACGGAACTGAACTCAGG
GGGACCTGGAGCCTTGAGGGAAATAAACTTATTGGAAAATTCAAACGGACAGACAATGGA
AACGAACTGAATACTGTCCGAGAAATTATAGGTGATGAACTAGTCCAGACTTATGTATAT
GAAGGAGTAGAAGCCAAAAGGATCTTTAAAAAGGATTGA
Protein Properties
Number of Residues 132
Molecular Weight 15207.2
Theoretical pI 7.52
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>Fatty acid-binding protein, intestinal
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD
GenBank ID Protein 46854681
UniProtKB/Swiss-Prot ID P12104
UniProtKB/Swiss-Prot Entry Name FABPI_HUMAN
PDB IDs
GenBank Gene ID BC069466
GeneCard ID FABP2
GenAtlas ID FABP2
HGNC ID HGNC:3556
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sweetser DA, Birkenmeier EH, Klisak IJ, Zollman S, Sparkes RS, Mohandas T, Lusis AJ, Gordon JI: The human and rodent intestinal fatty acid binding protein genes. A comparative analysis of their structure, expression, and linkage relationships. J Biol Chem. 1987 Nov 25;262(33):16060-71. [PubMed:2824476 ]
  3. Pelsers MM, Namiot Z, Kisielewski W, Namiot A, Januszkiewicz M, Hermens WT, Glatz JF: Intestinal-type and liver-type fatty acid-binding protein in the intestine. Tissue distribution and clinical utility. Clin Biochem. 2003 Oct;36(7):529-35. [PubMed:14563446 ]
  4. Darimont C, Gradoux N, de Pover A: Epidermal growth factor regulates fatty acid uptake and metabolism in Caco-2 cells. Am J Physiol. 1999 Mar;276(3 Pt 1):G606-12. [PubMed:10070036 ]
  5. Rajabzadeh M, Kao J, Frieden C: Consequences of single-site mutations in the intestinal fatty acid binding protein. Biochemistry. 2003 Oct 28;42(42):12192-9. [PubMed:14567680 ]
  6. Zhang F, Lucke C, Baier LJ, Sacchettini JC, Hamilton JA: Solution structure of human intestinal fatty acid binding protein: implications for ligand entry and exit. J Biomol NMR. 1997 Apr;9(3):213-28. [PubMed:9204553 ]
  7. Zhang F, Lucke C, Baier LJ, Sacchettini JC, Hamilton JA: Solution structure of human intestinal fatty acid binding protein with a naturally-occurring single amino acid substitution (A54T) that is associated with altered lipid metabolism. Biochemistry. 2003 Jun 24;42(24):7339-47. [PubMed:12809489 ]
  8. Baier LJ, Sacchettini JC, Knowler WC, Eads J, Paolisso G, Tataranni PA, Mochizuki H, Bennett PH, Bogardus C, Prochazka M: An amino acid substitution in the human intestinal fatty acid binding protein is associated with increased fatty acid binding, increased fat oxidation, and insulin resistance. J Clin Invest. 1995 Mar;95(3):1281-7. [PubMed:7883976 ]
  9. Kunsan X, Taisan Z, Weiping J, Duoqi S, Wei D, Jie L, Junxi L, Rong Z: The association of Ala54Thr variant of intestinal fatty acid binding protein gene with general and regional adipose tissue depots. Chin Med Sci J. 1999 Mar;14(1):46-51. [PubMed:12899384 ]