You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11436
Secondary Accession Numbers
  • 17779
Name Lambda-crystallin homolog
Synonyms
  1. Gul3DH
  2. L-gulonate 3-dehydrogenase
Gene Name CRYL1
Protein Type Unknown
Biological Properties
General Function Involved in 3-hydroxyacyl-CoA dehydrogenase activity
Specific Function Not Available
Pathways
  • Pentose and glucuronate interconversions
Reactions
Gulonic acid + NAD → 3-Dehydro-L-gulonate + NADH details
Gulonic acid + NAD → 3-Dehydro-L-gulonate + NADH + Hydrogen Ion details
GO Classification
Biological Process
fatty acid metabolic process
Cellular Component
cytosol
Function
binding
nucleotide binding
catalytic activity
nad or nadh binding
oxidoreductase activity, acting on the ch-oh group of donors, nad or nadp as acceptor
nad binding
3-hydroxyacyl-coa dehydrogenase activity
oxidoreductase activity, acting on ch-oh group of donors
oxidoreductase activity
Molecular Function
3-hydroxyacyl-CoA dehydrogenase activity
L-gulonate 3-dehydrogenase activity
NAD+ binding
Process
metabolic process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
monocarboxylic acid metabolic process
fatty acid metabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 13
Locus 13q12.11
SNPs CRYL1
Gene Sequence
>960 bp
ATGGCGTCCTCCGCGGCCGGCTGCGTGGTGATCGTTGGCAGTGGAGTCATTGGGCGAAGC
TGGGCCATGCTGTTTGCCAGTGGAGGCTTCCAGGTGAAACTCTATGACATTGAGCAACAG
CAGATAAGGAACGCCCTGGAAAACATCAGAAAGGAGATGAAGTTGCTGGAGCAGGCAGGT
TCTCTGAAAGGCTCCCTGAGTGTGGAAGAGCAGCTGTCACTCATCAGTGGTTGTCCCAAT
ATCCAAGAAGCAGTAGAGGGTGCCATGCACATTCAGGAATGTGTTCCAGAAGATCTAGAA
CTGAAGAAGAAGATTTTTGCTCAGTTAGATTCCATCATTGATGATCGAGTGATCTTAAGC
AGTTCCACTTCTTGTCTCATGCCTTCCAAGTTGTTTGCTGGCTTGGTCCATGTGAAGCAA
TGCATCGTGGCTCATCCTGTGAATCCGCCATACTACATCCCGCTGGTTGAGCTGGTCCCC
CACCCGGAGACGGCCCCTACGACAGTGGACAGAACCCACGCCCTGATGAAGAAGATTGGA
CAGTGCCCCATGCGAGTCCAGAAGGAGGTGGCCGGCTTCGTTCTGAACCGCCTGCAATAT
GCAATCATCAGCGAGGCCTGGCGGCTAGTGGAGGAAGGAATCGTGTCTCCTAGTGACCTG
GACCTTGTCATGTCAGAAGGGTTGGGCATGCGGTATGCATTCATTGGACCCCTGGAAACC
ATGCATCTCAATGCAGAAGGTATGTTAAGCTACTGCGACAGATACAGCGAAGGCATAAAA
CATGTCCTACAGACTTTTGGACCCATTCCAGAGTTTTCCAGGGCCACTGCTGAGAAGGTT
AACCAGGACATGTGCATGAAGGTCCCTGATGACCCGGAGCACTTAGCTGCCAGGAGGCAG
TGGAGGGACGAGTGCCTCATGAGACTCGCCAAGTTGAAGAGTCAAGTGCAGCCCCAGTGA
Protein Properties
Number of Residues 319
Molecular Weight 35418.91
Theoretical pI 6.175
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Lambda-crystallin homolog
MASSAAGCVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAG
SLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILS
SSTSCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIG
QCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRYAFIGPLET
MHLNAEGMLSYCDRYSEGIKHVLQTFGPIPEFSRATAEKVNQDMCMKVPDDPEHLAARRQ
WRDECLMRLAKLKSQVQPQ
GenBank ID Protein 115430219
UniProtKB/Swiss-Prot ID Q9Y2S2
UniProtKB/Swiss-Prot Entry Name CRYL1_HUMAN
PDB IDs
GenBank Gene ID NM_015974.2
GeneCard ID CRYL1
GenAtlas ID CRYL1
HGNC ID HGNC:18246
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  4. Chen J, Yu L, Li D, Gao Q, Wang J, Huang X, Bi G, Wu H, Zhao S: Human CRYL1, a novel enzyme-crystallin overexpressed in liver and kidney and downregulated in 58% of liver cancer tissues from 60 Chinese patients, and four new homologs from other mammalians. Gene. 2003 Jan 2;302(1-2):103-13. [PubMed:12527201 ]
  5. Ishikura S, Usami N, Araki M, Hara A: Structural and functional characterization of rabbit and human L-gulonate 3-dehydrogenase. J Biochem. 2005 Mar;137(3):303-14. [PubMed:15809331 ]