Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11451
Secondary Accession Numbers
  • 17796
Name GTP-binding protein SAR1b
Synonyms
  1. GTBPB
  2. GTP-binding protein B
Gene Name SAR1B
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function Involved in transport from the endoplasmic reticulum to the Golgi apparatus. Activated by the guanine nucleotide exchange factor PREB. Involved in the selection of the protein cargo and the assembly of the COPII coat complex
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
Process
establishment of localization
transport
protein transport
intracellular protein transport
Cellular Location
  1. Peripheral membrane protein
  2. Peripheral membrane protein
  3. Endoplasmic reticulum membrane
  4. Golgi apparatus
  5. Golgi stack membrane
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31.1
SNPs SAR1B
Gene Sequence
>597 bp
ATGTCCTTCATATTTGATTGGATTTACAGTGGTTTCAGCAGTGTGCTACAGTTTTTAGGA
TTATATAAGAAAACTGGTAAACTGGTATTTCTTGGATTGGATAATGCAGGAAAAACAACA
TTGCTACACATGCTAAAAGATGACAGACTTGGACAACATGTCCCAACATTACATCCCACT
TCCGAAGAACTGACCATTGCTGGCATGACGTTTACAACTTTTGATCTGGGTGGACATGTT
CAAGCTCGAAGAGTGTGGAAAAACTACCTTCCTGCTATCAATGGCATTGTATTTCTGGTG
GATTGTGCAGACCACGAAAGGCTGTTAGAGTCAAAAGAAGAACTTGATTCACTAATGACA
GATGAAACCATTGCTAATGTGCCTATACTGATTCTTGGGAATAAGATCGACAGACCTGAA
GCCATCAGTGAAGAGAGGTTGCGAGAGATGTTTGGTTTATATGGTCAGACAACAGGAAAG
GGGAGTATATCTCTGAAAGAACTGAATGCCCGACCCTTAGAAGTTTTCATGTGTAGTGTG
CTCAAAAGACAAGGTTACGGAGAAGGCTTCCGCTGGATGGCACAGTACATTGATTAA
Protein Properties
Number of Residues 198
Molecular Weight 22409.7
Theoretical pI 6.02
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>GTP-binding protein SAR1b
MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMT
DETIANVPILILGNKIDRPEAISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSV
LKRQGYGEGFRWMAQYID
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9Y6B6
UniProtKB/Swiss-Prot Entry Name SAR1B_HUMAN
PDB IDs
GenBank Gene ID AF092130
GeneCard ID SAR1B
GenAtlas ID SAR1B
HGNC ID HGNC:10535
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Jones B, Jones EL, Bonney SA, Patel HN, Mensenkamp AR, Eichenbaum-Voline S, Rudling M, Myrdal U, Annesi G, Naik S, Meadows N, Quattrone A, Islam SA, Naoumova RP, Angelin B, Infante R, Levy E, Roy CC, Freemont PS, Scott J, Shoulders CC: Mutations in a Sar1 GTPase of COPII vesicles are associated with lipid absorption disorders. Nat Genet. 2003 May;34(1):29-31. [PubMed:12692552 ]
  3. Annesi G, Aguglia U, Tarantino P, Annesi F, De Marco EV, Civitelli D, Torroni A, Quattrone A: SIL1 and SARA2 mutations in Marinesco-Sjogren and chylomicron retention diseases. Clin Genet. 2007 Mar;71(3):288-9. [PubMed:17309654 ]
  4. Treepongkaruna S, Chongviriyaphan N, Suthutvoravut U, Charoenpipop D, Choubtum L, Wattanasirichaigoon D: Novel missense mutations of SAR1B gene in an infant with chylomicron retention disease. J Pediatr Gastroenterol Nutr. 2009 Mar;48(3):370-3. [PubMed:19274794 ]