Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11452
Secondary Accession Numbers
  • 17797
Name Ras-GEF domain-containing family member 1A
Synonyms Not Available
Gene Name RASGEF1A
Protein Type Unknown
Biological Properties
General Function Involved in guanyl-nucleotide exchange factor activity
Specific Function Guanine nucleotide exchange factor (GEF) for KRAS, HRAS, and NRAS (in vitro). Plays a role in cell migration
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 10q11.21
SNPs RASGEF1A
Gene Sequence
>1446 bp
ATGCCCCAGACGTCCGTTGTCTTCTCCAGCATCCTTGGGCCCAGCTGTAGCGGACAGGTG
CAGCCTGGCATGGGGGAGCGTGGAGGCGGGGCCGGTGGCGGCTCCGGGGACCTCATCTTC
CAAGATGGACACCTCATCTCTGGGTCCCTGGAGGCCCTGATGGAGCACCTTGTTCCCACG
GTGGACTATTACCCCGATAGGACGTACATCTTCACCTTTCTCCTGAGCTCCCGGGTCTTT
ATGCCCCCTCATGACCTGCTGGCCCGCGTGGGGCAGATCTGCGTGGAGCAGAAGCAGCAG
CTGGAAGCCGGGCCTGAAAAGGCCAAGCTGAAGTCTTTCTCAGCCAAGATCGTGCAGCTC
CTGAAGGAGTGGACCGAGGCCTTCCCCTATGACTTCCAGGATGAGAAGGCCATGGCCGAG
CTGAAAGCCATCACACACCGTGTCACCCAGTGTGATGAGGAGAATGGCACAGTGAAGAAG
GCCATTGCCCAGATGACACAGAGCCTGTTGCTGTCCTTGGCTGCCCGGAGCCAGCTCCAG
GAACTGCGAGAGAAGCTCCGGCCACCGGCTGTAGACAAGGGGCCCATCCTCAAGACCAAG
CCACCAGCCGCCCAGAAGGACATCCTGGGCGTGTGCTGCGACCCCCTGGTGCTGGCCCAG
CAGCTGACTCACATTGAGCTGGACAGGGTCAGCAGCATTTACCCTGAGGACTTGATGCAG
ATCGTCAGCCACATGGACTCCTTGGACAACCACAGGTGCCGAGGGGACCTGACCAAGACC
TACAGCCTGGAGGCCTATGACAACTGGTTCAACTGCCTGAGCATGCTGGTGGCCACTGAG
GTGTGCCGGGTGGTGAAGAAGAAACACCGGACCCGCATGTTGGAGTTCTTCATTGATGTG
GCCCGGGAGTGCTTCAACATCGGGAACTTCAACTCCATGATGGCCATCATCTCTGGCATG
AACCTCAGTCCTGTGGCAAGGCTGAAGAAAACTTGGTCCAAGGTCAAGACAGCCAAGTTT
GATGTCTTGGAGCATCACATGGACCCGTCCAGCAACTTCTGCAACTACCGTACAGCCCTG
CAGGGGGCCACGCAGAGGTCCCAGATGGCCAACAGCAGCCGTGAAAAGATCGTCATCCCT
GTGTTCAACCTCTTCGTTAAGGACATCTACTTCCTGCACAAAATCCATACCAACCACCTG
CCCAACGGGCACATTAACTTTAAGAAATTCTGGGAGATCTCCAGACAGATCCATGAGTTC
ATGACATGGACACAGGTAGAGTGTCCTTTCGAGAAGGACAAGAAGATTCAGAGTTACCTG
CTCACGGCGCCCATCTACAGCGAGGAAGCTCTCTTCGTCGCCTCCTTTGAAAGTGAGGGT
CCCGAGAACCACATGGAAAAAGACAGCTGGAAGACCCTCAGGACCACCCTTCTGAACAGA
GCCTGA
Protein Properties
Number of Residues 481
Molecular Weight 54555.5
Theoretical pI 7.75
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ras-GEF domain-containing family member 1A
MPQTSVVFSSILGPSCSGQVQPGMGERGGGAGGGSGDLIFQDGHLISGSLEALMEHLVPT
VDYYPDRTYIFTFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQL
LKEWTEAFPYDFQDEKAMAELKAITHRVTQCDEENGTVKKAIAQMTQSLLLSLAARSQLQ
ELREKLRPPAVDKGPILKTKPPAAQKDILGVCCDPLVLAQQLTHIELDRVSSIYPEDLMQ
IVSHMDSLDNHRCRGDLTKTYSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRMLEFFIDV
ARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKVKTAKFDVLEHHMDPSSNFCNYRTAL
QGATQRSQMANSSREKIVIPVFNLFVKDIYFLHKIHTNHLPNGHINFKKFWEISRQIHEF
MTWTQVECPFEKDKKIQSYLLTAPIYSEEALFVASFESEGPENHMEKDSWKTLRTTLLNR
A
GenBank ID Protein 117168263
UniProtKB/Swiss-Prot ID Q8N9B8
UniProtKB/Swiss-Prot Entry Name RGF1A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_145313.2
GeneCard ID RASGEF1A
GenAtlas ID RASGEF1A
HGNC ID HGNC:24246
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Ura K, Obama K, Satoh S, Sakai Y, Nakamura Y, Furukawa Y: Enhanced RASGEF1A expression is involved in the growth and migration of intrahepatic cholangiocarcinoma. Clin Cancer Res. 2006 Nov 15;12(22):6611-6. [PubMed:17121879 ]