Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11453
Secondary Accession Numbers
  • 17798
Name G-protein-signaling modulator 1
Synonyms
  1. Activator of G-protein signaling 3
Gene Name GPSM1
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activator activity
Specific Function Guanine nucleotide dissociation inhibitor (GDI) which functions as a receptor-independent activator of heterotrimeric G- protein signaling. Keeps G(i/o) alpha subunit in its GDP-bound form thus uncoupling heterotrimeric G-proteins signaling from G protein-coupled receptors. Controls spindle orientation and asymmetric cell fate of cerebral cortical progenitors. May also be involved in macroautophagy in intestinal cells. May play a role in drug addiction
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
enzyme regulator activity
enzyme activator activity
gtpase activator activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Cellular Location
  1. Cell membrane
  2. Cytoplasm
  3. Golgi apparatus membrane
  4. Peripheral membrane protein
  5. Peripheral membrane protein
  6. Peripheral membrane protein
  7. Endoplasmic reticulum membrane
  8. Cytoplasmic side
  9. Cytoplasmic side
  10. Cytoplasmic side
  11. cytosol
Gene Properties
Chromosome Location Chromosome:9
Locus 9q34.3
SNPs GPSM1
Gene Sequence
>2028 bp
ATGGCGGGCCCGGCCCCGCCCGTGGCCGACGAGCTCCCGGGCCCGGCCGCCAGGCGCCTC
TACTCCAGGATGGAGGCGTCCTGCCTAGAGCTGGCGCTGGAGGGCGAGCGTCTGTGCAAG
GCGGGCGACTTCAAGACAGGCGTGGCCTTCTTTGAGGCTGCTGTGCAGGTGGGCACCGAG
GACCTGAAGACACTGAGTGCCATCTACAGCCAGCTGGGCAACGCCTACTTCTACCTGAAG
GAGCACGGCCGGGCGCTGGAATACCACAAGCATGACCTCCTGCTGGCGCGGACCATCGGT
GACCGCATGGGGGAGGCCAAGGCCAGTGGAAACCTGGGAAACACACTCAAGGTCCTGGGG
CGCTTCGACGAGGCTGCCGTCTGCTGCCAGCGGCATCTGAGCATCGCCCAAGAGCAGGGA
GACAAGGTTGGGGAGGCGAGGGCCCTCTACAACATCGGGAACGTGTACCACGCCAAAGGC
AAGCAACTGTCCTGGAACGCCGCAAACGCCACGCAGGACCCCGGGCACCTGCCGCCCGAT
GTCCGAGAGACCCTGTGCAAGGCCTCCGAGTTCTACGAGAGGAACCTGTCCCTGGTGAAG
GAGCTGGGCGACCGTGCGGCGCAGGGCAGGGCCTACGGCAACCTGGGCAACACCCACTAT
TTGTTGGGGAACTTCACAGAGGCCACGACCTTCCACAAGGAGCGCCTGGCCATTGCTAAG
GAGTTTGGAGACAAGGCAGCCGAGAGGAGGGCCTACAGCAACCTGGGGAACGCCCACGTC
TTCCTGGGGCGCTTTGACGTGGCCGCCGAGTACTACAAGAAGACGCTGCAACTGTCTCGG
CAGCTCAGGGACCAGGCAGTGGAGGCGCAGGCCTGCTACAGTCTGGGCAACACCTACACG
CTGCTGCAGGACTACGAGCGCGCGGCCGAGTACCACCTGCGGCACCTGCTCATTGCCCAG
GAGCTGGCCGACAGAGTGGGCGAGGGCCGGGCGTGCTGGAGCCTGGGAAATGCCTACGTG
TCCATGGGGCGCCCAGCGCAGGCCCTGACCTTCGCCAAGAAGCACCTGCAGATCTCCCAG
GAGATCGGGGACCGCCATGGGGAGCTCACGGCCCGCATGAACGTGGCGCAGCTGCAGCTG
GTGCTCGGCCGCCTGACCAGCCCGGCAGCCTCAGAGAAGCCTGACCTGGCCGGCTATGAG
GCCCAGGGGGCCAGACCCAAGAGGACGCAGAGGCTGAGCGCGGAGACCTGGGACCTGCTG
AGACTCCCCCTGGAGCGGGAGCAGAATGGAGACAGCCACCATTCAGGGGACTGGCGGGGG
CCCAGCAGGGACTCGCTACCCCTCCCCGTGAGGAGCAGGAAGTACCAGGAAGGCCCGGAC
GCTGAGAGGAGGCCCCGGGAGGGCAGCCACTCCCCGCTGGACAGCGCCGACGTCCGGGTG
CACGTGCCACGCACGAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTGCTTCTTTGAC
CTGTTGACCAAGTTCCAGAGCAGCCGCATGGACGACCAGCGTTGTCCCCTGGACGATGGC
CAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAGCCC
TCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGC
CGCCGGCTGGACGACCAGCGGGCCAGCGTGGGCAGCCTGCCGGGGCTGCGAATCACCCAC
AGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTCTTC
AACATGCTCATCAAGTACCAGTCCTCCAGGATCGATGACCAGCGCTGCCCGCCACCTGAC
GTACTGCCCCGGGGCCCTACCATGCCGGACGAGGACTTCTTCAGCCTCATTCAGAGGGTG
CAGGCTAAGCGCATGGACGAGCAGCGGGTGGACCTCGCCGGGGGCCCGGAGCAGGGGGCA
GGCGGCCCGCCCGAGCCCCAGCAGCAGTGCCAGCCTGGTGCGAGCTAA
Protein Properties
Number of Residues 675
Molecular Weight 74509.5
Theoretical pI 6.51
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>G-protein-signaling modulator 1
MAGPAPPVADELPGPAARRLYSRMEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTE
DLKTLSAIYSQLGNAYFYLKEHGRALEYHKHDLLLARTIGDRMGEAKASGNLGNTLKVLG
RFDEAAVCCQRHLSIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAANATQDPGHLPPD
VRETLCKASEFYERNLSLVKELGDRAAQGRAYGNLGNTHYLLGNFTEATTFHKERLAIAK
EFGDKAAERRAYSNLGNAHVFLGRFDVAAEYYKKTLQLSRQLRDQAVEAQACYSLGNTYT
LLQDYERAAEYHLRHLLIAQELADRVGEGRACWSLGNAYVSMGRPAQALTFAKKHLQISQ
EIGDRHGELTARMNVAQLQLVLGRLTSPAASEKPDLAGYEAQGARPKRTQRLSAETWDLL
RLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRKYQEGPDAERRPREGSHSPLDSADVRV
HVPRTSIPRAPSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAAEATAAPTLEDRIAQP
SMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFF
NMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGA
GGPPEPQQQCQPGAS
GenBank ID Protein 224548927
UniProtKB/Swiss-Prot ID Q86YR5
UniProtKB/Swiss-Prot Entry Name GPSM1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001145638.1
GeneCard ID GPSM1
GenAtlas ID GPSM1
HGNC ID HGNC:17858
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  7. Natochin M, Lester B, Peterson YK, Bernard ML, Lanier SM, Artemyev NO: AGS3 inhibits GDP dissociation from galpha subunits of the Gi family and rhodopsin-dependent activation of transducin. J Biol Chem. 2000 Dec 29;275(52):40981-5. [PubMed:11024022 ]
  8. Pattingre S, De Vries L, Bauvy C, Chantret I, Cluzeaud F, Ogier-Denis E, Vandewalle A, Codogno P: The G-protein regulator AGS3 controls an early event during macroautophagy in human intestinal HT-29 cells. J Biol Chem. 2003 Jun 6;278(23):20995-1002. Epub 2003 Mar 17. [PubMed:12642577 ]
  9. Izaki T, Kamakura S, Kohjima M, Sumimoto H: Two forms of human Inscuteable-related protein that links Par3 to the Pins homologues LGN and AGS3. Biochem Biophys Res Commun. 2006 Mar 24;341(4):1001-6. Epub 2006 Jan 24. [PubMed:16458856 ]
  10. An N, Blumer JB, Bernard ML, Lanier SM: The PDZ and band 4.1 containing protein Frmpd1 regulates the subcellular location of activator of G-protein signaling 3 and its interaction with G-proteins. J Biol Chem. 2008 Sep 5;283(36):24718-28. doi: 10.1074/jbc.M803497200. Epub 2008 Jun 19. [PubMed:18566450 ]