You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11460
Secondary Accession Numbers
  • 17807
Name Rho guanine nucleotide exchange factor 9
Synonyms
  1. Collybistin
  2. PEM-2 homolog
  3. Rac/Cdc42 guanine nucleotide exchange factor 9
Gene Name ARHGEF9
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Acts as guanine nucleotide exchange factor (GEF) for CDC42. Promotes formation of GPHN clusters
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs ARHGEF9
Gene Sequence
>1551 bp
ATGACGTTGCTGATCACTGGAGATTCCATCGTTAGTGCTGAGGCAGTATGGGATCACGTC
ACCATGGCCAACCGGGAGTTGGCATTTAAAGCTGGCGACGTCATCAAAGTCTTGGATGCT
TCCAACAAGGATTGGTGGTGGGGCCAGATCGACGATGAGGAGGGATGGTTTCCTGCCAGC
TTTGTGAGGCTCTGGGTGAACCAGGAGGATGAGGTGGAGGAGGGGCCCAGCGATGTGCAG
AACGGACACCTGGACCCCAATTCAGACTGCCTCTGTCTGGGGCGGCCACTACAGAACCGG
GACCAGATGCGGGCCAATGTCATCAATGAGATAATGAGCACTGAGCGTCACTACATCAAG
CACCTCAAGGATATTTGTGAGGGCTATCTGAAGCAGTGCCGGAAGAGAAGGGACATGTTC
AGTGACGAGCAACTGAAGGTAATCTTTGGGAACATTGAAGATATCTACAGATTTCAGATG
GGCTTTGTGAGAGACCTGGAGAAACAGTATAACAATGATGACCCCCACCTCAGCGAGATA
GGACCCTGCTTCCTAGAGCACCAAGATGGATTCTGGATATACTCTGAGTATTGTAACAAC
CACCTGGATGCTTGCATGGAGCTCTCCAAACTGATGAAGGACAGCCGCTACCAGCACTTC
TTTGAGGCCTGTCGCCTCTTGCAGCAGATGATTGACATTGCTATCGATGGTTTCCTTTTG
ACTCCAGTGCAGAAGATCTGCAAGTATCCCTTACAGTTGGCTGAGCTCCTAAAGTATACT
GCCCAAGACCACAGTGACTACAGGTATGTGGCAGCTGCTTTGGCTGTCATGAGAAATGTG
ACTCAGCAGATCAACGAACGCAAGCGACGTTTAGAGAATATTGACAAGATTGCTCAGTGG
CAGGCTTCTGTCCTAGACTGGGAGGGCGAGGACATCCTAGACAGGAGCTCGGAGCTGATC
TACACTGGGGAGATGGCCTGGATCTACCAGCCCTACGGCCGCAACCAGCAGCGGGTCTTC
TTCCTGTTTGACCACCAGATGGTCCTCTGCAAGAAGGACCTAATCCGGAGAGACATCCTG
TACTACAAAGGCCGCATTGACATGGATAAATATGAGGTAGTTGACATTGAGGATGGCAGA
GATGATGACTTCAATGTCAGCATGAAGAATGCCTTTAAGCTTCACAACAAGGAGACTGAG
GAGATACATCTGTTCTTTGCCAAGAAGCTGGAGGAAAAAATACGCTGGCTCAGGGCTTTC
AGAGAAGAGAGGAAAATGGTACAGGAAGATGAAAAAATTGGCTTTGAAATTTCTGAAAAC
CAGAAGAGGCAGGCTGCAATGACTGTGAGAAAAGTCCCTAAGCAAAAAGGTGTCAACTCT
GCCCGCTCAGTTCCTCCTTCCTACCCACCACCGCAGGACCCGTTAAACCACGGCCAGTAC
CTGGTCCCCGACGGCATCGCTCAGTCGCAGGTCTTTGAGTTCACCGAACCCAAGCGCAGC
CAGTCACCATTCTGGCAAAACTTCAGCAGGTTAACCCCCTTCAAAAAATGA
Protein Properties
Number of Residues 516
Molecular Weight 60981.8
Theoretical pI 5.44
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho guanine nucleotide exchange factor 9
MTLLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPAS
FVRLWVNQEDEVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIK
HLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEI
GPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLL
TPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQW
QASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDIL
YYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAF
REERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQY
LVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
GenBank ID Protein 7662108
UniProtKB/Swiss-Prot ID O43307
UniProtKB/Swiss-Prot Entry Name ARHG9_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015185.2
GeneCard ID ARHGEF9
GenAtlas ID ARHGEF9
HGNC ID HGNC:14561
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  3. Ishikawa K, Nagase T, Nakajima D, Seki N, Ohira M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1997 Oct 31;4(5):307-13. [PubMed:9455477 ]
  4. Reid T, Bathoorn A, Ahmadian MR, Collard JG: Identification and characterization of hPEM-2, a guanine nucleotide exchange factor specific for Cdc42. J Biol Chem. 1999 Nov 19;274(47):33587-93. [PubMed:10559246 ]
  5. Harvey K, Duguid IC, Alldred MJ, Beatty SE, Ward H, Keep NH, Lingenfelter SE, Pearce BR, Lundgren J, Owen MJ, Smart TG, Luscher B, Rees MI, Harvey RJ: The GDP-GTP exchange factor collybistin: an essential determinant of neuronal gephyrin clustering. J Neurosci. 2004 Jun 23;24(25):5816-26. [PubMed:15215304 ]