Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11466
Secondary Accession Numbers
  • 17815
Name Guanine nucleotide-binding protein G(t) subunit alpha-2
Synonyms
  1. Transducin alpha-2 chain
Gene Name GNAT2
Protein Type Unknown
Biological Properties
General Function Involved in signal transducer activity
Specific Function Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
molecular transducer activity
signal transducer activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1p13.1
SNPs GNAT2
Gene Sequence
>1065 bp
ATGGGAAGTGGAGCCAGTGCTGAGGACAAAGAACTGGCCAAGAGGTCCAAGGAGCTAGAA
AAGAAGCTGCAGGAGGATGCTGATAAGGAAGCCAAGACTGTCAAGCTGCTACTGCTGGGT
GCTGGGGAGTCAGGAAAGAGCACCATCGTCAAACAGATGAAGATCATTCACCAGGATGGC
TATTCACCAGAAGAATGCCTGGAGTTCAAGGCTATCATCTATGGAAATGTGCTGCAGTCC
ATCCTGGCTATCATCCGGGCCATGACCACACTGGGCATCGATTATGCTGAACCAAGCTGT
GCGGATGACGGGCGACAGCTCAACAACCTGGCTGACTCCATTGAGGAGGGAACCATGCCT
CCTGAGCTCGTGGAGGTCATTAGGAGGTTGTGGAAGGATGGTGGGGTGCAAGCCTGCTTC
GAGAGAGCTGCAGAATACCAGCTTAATGACTCCGCATCTTACTACCTGAACCAATTAGAA
CGAATTACAGACCCTGAGTACCTCCCTAGTGAGCAAGATGTGCTCCGATCCAGAGTCAAA
ACCACGGGCATCATTGAAACCAAGTTTTCCGTCAAAGACTTGAATTTCAGGATGTTTGAT
GTGGGAGGGCAGAGATCCGAGAGAAAGAAGTGGATCCACTGCTTCGAGGGAGTCACCTGC
ATCATTTTCTGTGCAGCCCTCAGTGCCTATGATATGGTGCTGGTGGAAGATGACGAAGTG
AATCGTATGCATGAGTCTTTGCATCTGTTCAACAGCATATGTAACCACAAATTCTTTGCG
GCTACTTCCATTGTCCTCTTTCTCAACAAGAAGGACCTCTTTGAGGAAAAAATCAAGAAA
GTCCATCTCAGCATTTGTTTTCCAGAGTATGATGGTAACAACTCCTATGATGATGCGGGG
AATTACATAAAGAGCCAGTTCCTTGACCTCAATATGCGAAAAGATGTCAAAGAAATCTAC
AGTCACATGACCTGTGCTACAGATACACAGAATGTCAAATTTGTGTTTGATGCAGTTACA
GATATTATCATCAAAGAAAACCTCAAGGACTGCGGCCTCTTCTAA
Protein Properties
Number of Residues 354
Molecular Weight 40175.4
Theoretical pI 4.87
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Guanine nucleotide-binding protein G(t) subunit alpha-2
MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDG
YSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMP
PELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVK
TTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEV
NRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAG
NYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
GenBank ID Protein 20147711
UniProtKB/Swiss-Prot ID P19087
UniProtKB/Swiss-Prot Entry Name GNAT2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF493909
GeneCard ID GNAT2
GenAtlas ID GNAT2
HGNC ID HGNC:4394
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nishiguchi KM, Sandberg MA, Gorji N, Berson EL, Dryja TP: Cone cGMP-gated channel mutations and clinical findings in patients with achromatopsia, macular degeneration, and other hereditary cone diseases. Hum Mutat. 2005 Mar;25(3):248-58. [PubMed:15712225 ]
  3. Lerea CL, Bunt-Milam AH, Hurley JB: Alpha transducin is present in blue-, green-, and red-sensitive cone photoreceptors in the human retina. Neuron. 1989 Sep;3(3):367-76. [PubMed:2534964 ]
  4. Kubo M, Hirano T, Kakinuma M: Molecular cloning and sequence analysis of cDNA and genomic DNA for the human cone transducin alpha subunit. FEBS Lett. 1991 Oct 21;291(2):245-8. [PubMed:1936270 ]
  5. Morris TA, Fong SL: Characterization of the gene encoding human cone transducin alpha-subunit (GNAT2). Genomics. 1993 Aug;17(2):442-8. [PubMed:8406495 ]
  6. Kohl S, Baumann B, Rosenberg T, Kellner U, Lorenz B, Vadala M, Jacobson SG, Wissinger B: Mutations in the cone photoreceptor G-protein alpha-subunit gene GNAT2 in patients with achromatopsia. Am J Hum Genet. 2002 Aug;71(2):422-5. Epub 2002 Jun 20. [PubMed:12077706 ]