Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11470
Secondary Accession Numbers
  • 17819
Name Guanine nucleotide-binding protein G(o) subunit alpha
Synonyms Not Available
Gene Name GNAO1
Protein Type Unknown
Biological Properties
General Function Involved in signal transducer activity
Specific Function Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
molecular transducer activity
signal transducer activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 16q13
SNPs GNAO1
Gene Sequence
>1065 bp
ATGGGATGTACTCTGAGCGCAGAGGAGAGAGCCGCCCTCGAGCGGAGCAAGGCGATTGAG
AAAAACCTCAAAGAGGATGGCATCAGCGCCGCCAAAGACGTGAAATTACTCCTGCTCGGG
GCTGGAGAATCAGGAAAAAGCACCATTGTGAAGCAGATGAAGATCATCCATGAAGATGGC
TTCTCCGGAGAAGACGTGAAACAGTACAAGCCTGTTGTCTACAGCAACACTATCCAGTCC
CTGGCAGCCATCGTCCGGGCCATGGACACTTTGGGCATCGAATATGGTGATAAGGAGAGA
AAGGCTGACGCCAAGATGGTGTGTGATGTGGTGAGTCGGATGGAAGACACCGAGCCCTTC
TCTGCAGAGCTGCTTTCTGCCATGATGCGGCTCTGGGGCGACTCAGGAATCCAAGAGTGC
TTCAACCGGTCCCGGGAGTATCAGCTCAACGACTCTGCCAAATACTACCTGGACAGCCTG
GATCGGATTGGGGCCGCCGACTACCAGCCCACCGAGCAGGACATCCTCCGAACCAGGGTC
AAAACCACTGGCATCGTAGAAACCCACTTCACATTCAAGAACCTCCACTTCAGGCTGTTT
GACGTCGGAGGCCAGCGATCTGAACGCAAGAAGTGGATCCATTGCTTCGAGGACGTCACG
GCCATCATTTTCTGTGTCGCGCTCAGCGGCTATGACCAGGTGCTCCACGAAGACGAAACC
ACGAACCGCATGCACGAGTCTCTCATGCTCTTCGACTCCATCTGTAACAACAAGTTCTTC
ATCGATACCTCCATCATTCTCTTCCTCAACAAGAAAGATCTCTTTGGCGAGAAGATCAAG
AAGTCACCTTTGACCATCTGCTTTCCTGAATACACAGGCCCCAATACCTATGAAGACGCA
GCCGCCTACATCCAAGCACAATTTGAAAGCAAAAACCGCTCACCCAACAAAGAAATATAT
TGTCACATGACTTGTGCCACAGACACGAATAACATCCAGGTGGTGTTCGACGCCGTCACC
GACATCATCATTGCCAACAACCTCCGGGGCTGCGGCTTGTACTGA
Protein Properties
Number of Residues 354
Molecular Weight 40050.2
Theoretical pI 5.19
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Guanine nucleotide-binding protein G(o) subunit alpha
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDA
AAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
GenBank ID Protein 20147681
UniProtKB/Swiss-Prot ID P09471
UniProtKB/Swiss-Prot Entry Name GNAO_HUMAN
PDB IDs Not Available
GenBank Gene ID AF493894
GeneCard ID GNAO1
GenAtlas ID GNAO1
HGNC ID HGNC:4389
References
General References
  1. Tsukamoto T, Toyama R, Itoh H, Kozasa T, Matsuoka M, Kaziro Y: Structure of the human gene and two rat cDNAs encoding the alpha chain of GTP-binding regulatory protein Go: two different mRNAs are generated by alternative splicing. Proc Natl Acad Sci U S A. 1991 Apr 15;88(8):2974-8. [PubMed:1901650 ]
  2. Lavu S, Clark J, Swarup R, Matsushima K, Paturu K, Moss J, Kung HF: Molecular cloning and DNA sequence analysis of the human guanine nucleotide-binding protein Go alpha. Biochem Biophys Res Commun. 1988 Jan 29;150(2):811-5. [PubMed:3124840 ]
  3. Duc-Goiran P, Bourgeois C, Mignot TM, Robert B, Tanguy G, Ferre F: Identification and expression of Go1 and Go2 alpha-subunit transcripts in human myometrium in relation to pregnancy. Biol Reprod. 1999 Jun;60(6):1528-35. [PubMed:10330115 ]