You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11477
Secondary Accession Numbers
  • 17826
Name Ral guanine nucleotide dissociation stimulator-like 1
Synonyms
  1. RalGDS-like 1
Gene Name RGL1
Protein Type Unknown
Biological Properties
General Function Involved in signal transduction
Specific Function Probable guanine nucleotide exchange factor
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1q25.3
SNPs RGL1
Gene Sequence
>2307 bp
ATGAAATTGCTTTGGCAAGCTAAAATGAGCTCGATTCAGGACTGGGGTGAAGAGGTAGAG
GAAGGAGCTGTTTACCATGTCACCCTCAAAAGAGTCCAGATTCAACAGGCTGCCAATAAA
GGAGCAAGATGGCTAGGGGTTGAAGGGGACCAGCTGCCTCCAGGACACACAGTCAGTCAA
TATGAAACCTGTAAGATCAGGACCATAAAAGCTGGCACCTTGGAGAAGCTTGTGGAGAAC
CTGCTGACAGCTTTTGGGGACAATGACTTTACCTATATCAGCATCTTTCTTTCAACGTAC
AGAGGCTTTGCCTCCACTAAAGAAGTGCTGGAACTACTGCTGGACAGGTATGGAAACCTG
ACAAGCCCAAACTGTGAAGAAGATGGAAGCCAAAGTTCATCAGAGTCCAAAATGGTGATC
AGGAATGCAATCGCTTCCATACTAAGGGCCTGGCTTGACCAGTGTGCAGAAGACTTCCGA
GAGCCCCCTCACTTCCCTTGCTTACAGAAACTGCTGGATTATCTCACACGGATGATGCCG
GGCTCTGACCCAGAAAGAAGAGCACAAAATCTTCTTGAGCAGTTTCAGAAGCAAGAAGTG
GAAACTGACAATGGGCTTCCCAACACGATCTCCTTCAGCCTGGAAGAGGAAGAGGAACTG
GAGGGTGGAGAGTCAGCAGAATTCACGTGCTTCTCAGAAGATCTCGTGGCAGAGCAGCTG
ACCTACATGGATGCACAACTCTTCAAGAAAGTAGTGCCTCACCACTGCCTGGGCTGCATT
TGGTCTCGAAGGGATAAGAAGGAAAACAAACATTTGGCTCCTACGATCCGTGCCACCATC
TCTCAGTTTAATACCCTCACCAAATGTGTTGTCAGCACCATCCTGGGGGGCAAAGAACTC
AAAACTCAGCAGAGAGCCAAAATCATTGAGAAGTGGATCAACATCGCTCATGAATGTAGA
CTCCTGAAGAATTTTTCCTCCTTGAGGGCCATCGTTTCGGCACTGCAGTCTAATTCCATC
TATCGGTTAAAAAAGACTTGGGCTGCCGTCCCAAGGGACCGAATGCTGATGTTTGAAGAA
CTTTCAGATATCTTCTCAGACCATAATAACCATTTGACCAGCCGAGAACTACTGATGAAG
GAAGGAACCTCAAAATTTGCAAACCTGGACAGCAGTGTGAAAGAAAACCAGAAGCGTACC
CAGAGGCGGCTGCAGCTCCAGAAGGACATGGGTGTGATGCAGGGAACTGTGCCCTACCTG
GGCACCTTCCTGACTGACCTGACCATGCTTGACACTGCCCTTCAGGACTACATCGAGGGT
GGACTGATAAACTTTGAGAAAAGGAGAAGGGAATTTGAAGTGATTGCCCAGATAAAGCTC
TTACAGTCTGCCTGCAACAGCTATTGCATGACCCCAGACCAAAAGTTCATCCAGTGGTTC
CAGAGGCAGCAGCTCCTGACAGAGGAGGAGAGCTATGCCCTGTCATGTGAGATTGAAGCA
GCTGCTGACGCCAGCACCACCTCGCCCAAGCCTCGGAAGAGCATGGTGAAGAGACTCAGC
CTACTGTTTCTAGGGTCTGACATGATCACCAGTCCCACTCCCACCAAAGAGCAGCCCAAG
TCCACTGCCAGCGGGAGCTCTGGTGAAAGCATGGACTCTGTCAGCGTGTCATCCTGCGAG
TCGAACCACTCAGAGGCTGAGGAGGGCTCCATTACTCCCATGGACACCCCTGATGAGCCT
CAAAAAAAGCTCTCTGAGTCCTCCTCATCCTGTTCTTCTATCCATTCCATGGACACAAAT
TCCTCAGGGATGTCTTCCTTAATCAACCCCCTCTCCTCCCCTCCGTCCTGCAACAACAAC
CCCAAAATCCACAAGCGCTCTGTCTCGGTGACGTCCATTACCTCGACTGTGCTGCCTCCT
GTTTACAACCAACAGAATGAAGACACCTGCATAATCCGCATCAGTGTGGAAGACAATAAC
GGCAACATGTACAAGAGCATCATGTTGACGAGCCAGGATAAAACCCCCGCTGTGATCCAG
AGAGCCATGCTGAAGCACAATCTGGACTCAGACCCCGCCGAGGAGTACGAGCTGGTGCAG
GTCATCTCGGAGGACAAAGAACTTGTGATTCCAGACTCAGCAAATGTCTTTTATGCCATG
AACAGCCAAGTGAACTTTGACTTCATTTTGCGCAAAAAGAACTCCATGGAAGAACAAGTG
AAACTGCGTAGCCGGACCAGCTTGACGTTGCCCAGGACAGCTAAACGGGGCTGCTGGAGT
AACAGACACAGCAAAATCACCCTCTGA
Protein Properties
Number of Residues 768
Molecular Weight 86700.5
Theoretical pI 5.96
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ral guanine nucleotide dissociation stimulator-like 1
MKLLWQAKMSSIQDWGEEVEEGAVYHVTLKRVQIQQAANKGARWLGVEGDQLPPGHTVSQ
YETCKIRTIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNL
TSPNCEEDGSQSSSESKMVIRNAIASILRAWLDQCAEDFREPPHFPCLQKLLDYLTRMMP
GSDPERRAQNLLEQFQKQEVETDNGLPNTISFSLEEEEELEGGESAEFTCFSEDLVAEQL
TYMDAQLFKKVVPHHCLGCIWSRRDKKENKHLAPTIRATISQFNTLTKCVVSTILGGKEL
KTQQRAKIIEKWINIAHECRLLKNFSSLRAIVSALQSNSIYRLKKTWAAVPRDRMLMFEE
LSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYL
GTFLTDLTMLDTALQDYIEGGLINFEKRRREFEVIAQIKLLQSACNSYCMTPDQKFIQWF
QRQQLLTEEESYALSCEIEAAADASTTSPKPRKSMVKRLSLLFLGSDMITSPTPTKEQPK
STASGSSGESMDSVSVSSCESNHSEAEEGSITPMDTPDEPQKKLSESSSSCSSIHSMDTN
SSGMSSLINPLSSPPSCNNNPKIHKRSVSVTSITSTVLPPVYNQQNEDTCIIRISVEDNN
GNMYKSIMLTSQDKTPAVIQRAMLKHNLDSDPAEEYELVQVISEDKELVIPDSANVFYAM
NSQVNFDFILRKKNSMEEQVKLRSRTSLTLPRTAKRGCWSNRHSKITL
GenBank ID Protein 7682471
UniProtKB/Swiss-Prot ID Q9NZL6
UniProtKB/Swiss-Prot Entry Name RGL1_HUMAN
PDB IDs
GenBank Gene ID AF186779
GeneCard ID RGL1
GenAtlas ID RGL1
HGNC ID HGNC:30281
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  5. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Feb 26;6(1):63-70. [PubMed:10231032 ]
  6. Sood R, Makalowska I, Carpten JD, Robbins CM, Stephan DA, Connors TD, Morgenbesser SD, Su K, Pinkett HW, Graham CL, Quesenberry MI, Baxevanis AD, Klinger KW, Trent JM, Bonner TI: The human RGL (RalGDS-like) gene: cloning, expression analysis and genomic organization. Biochim Biophys Acta. 2000 Apr 25;1491(1-3):285-8. [PubMed:10760592 ]