You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11486
Secondary Accession Numbers
  • 17836
Name Rho guanine nucleotide exchange factor 11
Synonyms
  1. PDZ-RhoGEF
Gene Name ARHGEF11
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and GNA13
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
intracellular
Function
small gtpase regulator activity
binding
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
protein binding
molecular transducer activity
signal transducer activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cytoplasm
  2. Membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 1q21
SNPs ARHGEF11
Gene Sequence
>4569 bp
ATGAGTGTAAGGTTACCCCAGAGTATAGACAGGTTAAGTAGCCTGTCTTCTCTGGGAGAT
TCTGCACCAGAGCGCAAGTCCCCTTCCCACCATCGCCAGCCTTCGGATGCCTCTGAGACA
ACAGGTCTCGTTCAACGCTGTGTCATTATCCAAAAGGACCAGCATGGCTTCGGCTTCACA
GTCAGTGGGGATCGCATTGTTCTGGTGCAGTCTGTGCGGCCTGGAGGTGCAGCCATGAAG
GCCGGTGTGAAAGAGGGCGACCGGATCATCAAAGTCAACGGCACCATGGTGACCAATAGC
TCACACCTGGAAGTGGTAAAGCTGATCAAATCTGGCGCCTATGTCGCACTCACCCTCCTG
GGCTCTTCACCTTCATCCATGGGCATCTCTGGGCTCCAGCAGGACCCATCCCCAGCAGGA
GCTCCCCGAATCACGTCAGTGATCCCCTCACCACCACCTCCTCCACCTCTACCACCTCCA
CAACGCATCACAGGACCCAAACCTCTGCAGGATCCCGAAGTTCAAAAACATGCCACCCAG
ATCCTCAGGAATATGCTGAGGCAGGAAGAAAAAGAATTACAGGACATACTTCCACTATAT
GGTGACACCAGCCAGAGACCATCAGAAGGCCGGCTCTCTCTGGATTCCCAGGAGGGGGAC
AGTGGCTTGGACTCTGGGACAGAACGCTTTCCTTCCCTCAGTGAGTCATTGATGAATCGG
AACTCGGTACTGTCAGACCCTGGGCTAGACAGTCCTCGAACCTCCCCTGTGATCATGGCC
AGGGTGGCCCAGCACCACAGGCGGCAGGGCTCGGATGCAGCAGTCCCCTCAACCGGTGAC
CAGGGTGTAGATCAAAGCCCAAAGCCTTTAATTATTGGCCCAGAGGAAGACTATGACCCG
GGTTATTTCAACAACGAGAGCGACATCATATTCCAGGATCTGGAGAAACTGAAGTCTCGG
CCAGCTCACCTGGGGGTTTTTCTACGTTACATCTTCTCTCAGGCGGACCCCAGTCCACTG
CTTTTTTACCTGTGTGCAGAAGTTTATCAGCAGGCAAGCCCCAAGGATTCCCGAAGCTTG
GGGAAAGACATCTGGAATATTTTCCTGGAGAAAAATGCGCCTCTGAGAGTGAAGATCCCT
GAGATGCTACAGGCTGAAATTGACTCGCGCCTGCGGAACAGCGAAGATGCCCGTGGTGTT
CTCTGTGAAGCTCAAGAGGCAGCCATGCCTGAGATCCAAGAGCAGATCCACGACTACAGA
ACGAAGCGCACACTGGGGCTGGGCAGCCTGTATGGTGAAAATGACCTGCTGGACCTGGAT
GGGGACCCTCTCCGAGAGCGCCAAGTGGCTGAGAAGCAGCTGGCTGCCCTTGGAGATATT
TTGTCCAAGTATGAGGAAGACAGGAGCGCCCCCATGGACTTCGCCCTCAATACCTACATG
AGCCATGCTGGGATCCGTCTTCGAGAGGCACGACCTTCCAACACAGCTGAAAAGGCCCAG
TCTGCTCCTGACAAGGACAAGTGGCTACCGTTCTTCCCTAAGACCAAGAAGAGCAGCAAT
TCCAAGAAAGAAAAGGATGCCTTGGAGGACAAGAAGCGAAACCCTATCCTCAAATACATT
GGGAAGCCCAAAAGCTCTTCTCAAAGCACATTTCATATTCCCTTGTCCCCTGTGGAAGTC
AAACCAGGCAATGTGAGGAACATCATTCAGCACTTTGAGAACAACCAGCAGTATGATGCC
CCAGAACCTGGGACACAACGACTCTCGACCGGAAGCTTTCCTGAGGACCTGCTGGAGAGT
GACAGTTCACGCTCAGAGATTCGCCTGGGCCGCTCTGAAAGCCTCAAGGGCCGGGAAGAG
ATGAAACGGTCTCGAAAGGCAGAGAACGTGCCCCGCTCTCGCAGTGATGTTGACATGGAT
GCTGCTGCGGAGGCTACTCGCCTGCACCAGTCAGCCTCGTCCTCTACCTCCAGCCTCTCC
ACCAGGTCTCTTGAGAACCCAACCCCTCCATTCACTCCCAAAATGGGCCGCAGGAGCATT
GAGTCCCCCAGTTTGGGGTTCTGCACAGATACCCTCCTTCCCCACCTCCTAGAGGATGAT
CTGGGCCAGCTGTCTGACCTGGAGCCAGAGCCAGATGCCCAAAATTGGCAGCATACAGTG
GGCAAGGATGTGGTGGCTGGGCTAACCCAGCGGGAGATTGACCGGCAAGAGGTCATCAAT
GAGCTGTTTGTGACTGAAGCTTCCCACCTGCGCACACTCCGGGTCCTGGACCTGATCTTC
TACCAGCGAATGAAGAAGGAGAACCTGATGCCCCGGGAGGAGCTGGCCCGGCTCTTCCCG
AACCTGCCTGAACTCATAGAGATTCACAATTCCTGGTGTGAAGCCATGAAGAAGCTCCGG
GAGGAAGGCCCCATCATCAAAGAGATCAGTGACCTCATGCTGGCCCGGTTTGATGGCCCT
GCCCGAGAGGAACTCCAGCAAGTGGCTGCACAGTTCTGTTCCTATCAGTCAATAGCCCTA
GAGCTAATCAAGACCAAGCAACGCAAGGAGAGTCGATTCCAGCTCTTCATGCAGGAGGCT
GAGAGCCACCCTCAGTGTCGGCGGCTGCAGCTGAGAGACCTCATCATCTCTGAGATGCAG
CGGCTCACCAAGTACCCGCTGCTGCTGGAGAGCATCATCAAGCACACAGAGGGTGGCACC
TCTGAGCATGAGAAGCTGTGCCGGGCCCGGGACCAGTGCCGGGAGATTCTCAAGTATGTG
AATGAAGCGGTAAAACAAACAGAGAACCGCCACCGTTTAGAGGGCTACCAGAAACGCCTG
GATGCCACCGCCCTGGAGAGGGCCAGCAACCCCCTGGCAGCAGAGTTCAAGAGCCTGGAT
CTTACAACCAGAAAAATGATCCATGAGGGACCCCTGACCTGGAGGATCAGCAAGGATAAG
ACCTTGGACCTCCACGTGCTGCTGCTGGAGGACCTCCTAGTGCTGCTACAGAAACAGGAT
GAGAAGCTATTGCTGAAGTGCCACAGCAAGACTGCTGTGGGCTCCTCAGACAGCAAGCAG
ACCTTCAGCCCCGTGCTCAAGCTCAATGCTGTGCTCATCCGCTCTGTGGCCACAGATAAA
CGGGCCTTCTTCATCATCTGCACCTCCAAGCTGGGCCCACCCCAGATCTATGAGCTGGTT
GCATTGACGTCATCAGACAAGAACACATGGATGGAGCTCTTAGAAGAGGCCGTGCGGAAT
GCCACCAGGCACCCCGGAGCTGCCCCAATGCCCGTCCATCCTCCACCCCCAGGTCCCCGG
GAGCCAGCCCAGCAGGGCCCCACACCCAGCAGGGTAGAACTGGATGACTCAGACGTGTTC
CATGGTGAACCTGAACCTGAGGAGCTGCCTGGAGGCACTGGGTCCCAGCAGAGGGTCCAA
GGGAAGCACCAGGTCCTGCTAGAGGACCCTGAGCAGGAGGGCAGTGCAGAGGAAGAGGAA
CTGGGTGTCCTGCCTTGCCCTTCCACATCCCTGGATGGAGAGAACAGGGGCATCAGGACA
AGGAACCCCATCCACTTGGCCTTCCCAGGCCCTCTGTTCATGGAAGGGCTCGCTGACTCC
GCTCTGGAAGATGTGGAGAACCTGCGACATCTGATCCTGTGGAGCCTGCTGCCAGGTCAC
ACCATGGAAACTCAGGCTGCCCAGGAGCCCGAGGACGACCTGACACCCACACCTTCTGTC
ATCAGCGTCACCTCTCACCCCTGGGACCCAGGCTCCCCAGGGCAAGCACCCCCTGGGGGT
GAAGGGGACAACACCCAGCTTGCAGGGCTGGAGGGGGAACGGCCAGAGCAGGAAGACATG
GGTCTCTGTTCTCTGGAACACCTACCCCCAAGGACCAGAAATTCTGGGATATGGGAGTCT
CCAGAACTGGACAGGAATCTGGCTGAAGATGCTTCAAGCACAGAGGCAGCAGGAGGTTAC
AAAGTTGTGAGAAAAGCTGAGGTGGCAGGCAGCAAGGTTGTCCCTGCACTACCAGAGAGT
GGCCAGTCAGAGCCTGGGCCACCTGAAGTGGAAGGCGGAACAAAGGCTACGGGGAACTGC
TTTTATGTCAGCATGCCATCAGGACCCCCGGACTCAAGCACCGACCACTCAGAGGCACCC
ATGAGCCCCCCTCAGCCTGACAGCCTCCCTGCAGGGCAGACAGAGCCTCAGCCTCAGCTG
CAGGGAGGCAACGATGATCCAAGACGCCCCAGCCGCTCTCCTCCAAGCCTGGCCCTCAGG
GACGTGGGCATGATCTTCCATACCATTGAGCAGCTCACTCTCAAGCTCAACAGGCTCAAG
GATATGGAGCTGGCCCACAGAGAGCTGCTCAAGTCCCTTGGGGGAGAGTCATCTGGTGGC
ACCACGCCTGTGGGCAGTTTCCACACAGAAGCAGCTAGATGGACAGATGGCTCCCTCTCA
CCTCCCGCTAAGGAGCCCCTAGCTTCTGACTCCAGGAACAGCCATGAACTGGGGCCCTGC
CCTGAGGATGGCTCTGACGCCCCCCTGGAAGACAGCACAGCAGACGCAGCCGCGTCACCA
GGACCATAA
Protein Properties
Number of Residues 1522
Molecular Weight 167702.8
Theoretical pI 5.18
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho guanine nucleotide exchange factor 11
MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSMGISGLQQDPSPAGAPRITSVIPSPPPPPPLPPPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQDILPLYGDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNR
NSVLSDPGLDSPRTSPVIMARVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDP
GYFNNESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSL
GKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYR
TKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYM
SHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYI
GKPKSSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLES
DSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLS
TRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPEPDAQNWQHTV
GKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFP
NLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIAL
ELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGT
SEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLD
LTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQ
TFSPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRN
ATRHPGAAPMPVHPPPPGPREPAQQGPTPSRVELDDSDVFHGEPEPEELPGGTGSQQRVQ
GKHQVLLEDPEQEGSAEEEELGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADS
ALEDVENLRHLILWSLLPGHTMETQAAQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGG
EGDNTQLAGLEGERPEQEDMGLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGY
KVVRKAEVAGSKVVPALPESGQSEPGPPEVEGGTKATGNCFYVSMPSGPPDSSTDHSEAP
MSPPQPDSLPAGQTEPQPQLQGGNDDPRRPSRSPPSLALRDVGMIFHTIEQLTLKLNRLK
DMELAHRELLKSLGGESSGGTTPVGSFHTEAARWTDGSLSPPAKEPLASDSRNSHELGPC
PEDGSDAPLEDSTADAAASPGP
GenBank ID Protein 7662086
UniProtKB/Swiss-Prot ID O15085
UniProtKB/Swiss-Prot Entry Name ARHGB_HUMAN
PDB IDs
GenBank Gene ID NM_014784.2
GeneCard ID ARHGEF11
GenAtlas ID ARHGEF11
HGNC ID HGNC:14580
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  8. Rumenapp U, Blomquist A, Schworer G, Schablowski H, Psoma A, Jakobs KH: Rho-specific binding and guanine nucleotide exchange catalysis by KIAA0380, a dbl family member. FEBS Lett. 1999 Oct 15;459(3):313-8. [PubMed:10526156 ]
  9. Fukuhara S, Murga C, Zohar M, Igishi T, Gutkind JS: A novel PDZ domain containing guanine nucleotide exchange factor links heterotrimeric G proteins to Rho. J Biol Chem. 1999 Feb 26;274(9):5868-79. [PubMed:10026210 ]
  10. Driessens MH, Olivo C, Nagata K, Inagaki M, Collard JG: B plexins activate Rho through PDZ-RhoGEF. FEBS Lett. 2002 Oct 9;529(2-3):168-72. [PubMed:12372594 ]
  11. Perrot V, Vazquez-Prado J, Gutkind JS: Plexin B regulates Rho through the guanine nucleotide exchange factors leukemia-associated Rho GEF (LARG) and PDZ-RhoGEF. J Biol Chem. 2002 Nov 8;277(45):43115-20. Epub 2002 Aug 14. [PubMed:12183458 ]
  12. Togashi H, Nagata K, Takagishi M, Saitoh N, Inagaki M: Functions of a rho-specific guanine nucleotide exchange factor in neurite retraction. Possible role of a proline-rich motif of KIAA0380 in localization. J Biol Chem. 2000 Sep 22;275(38):29570-8. [PubMed:10900204 ]
  13. Longenecker KL, Lewis ME, Chikumi H, Gutkind JS, Derewenda ZS: Structure of the RGS-like domain from PDZ-RhoGEF: linking heterotrimeric g protein-coupled signaling to Rho GTPases. Structure. 2001 Jul 3;9(7):559-69. [PubMed:11470431 ]