You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11491
Secondary Accession Numbers
  • 17842
Name Protein SOLO
Synonyms Not Available
Gene Name SOLO
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function May act as a guanine nucleotide exchange factor (GEF)
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs SOLO
Gene Sequence
>4560 bp
ATGGAGCCTGAGCCAGTGGAGGACTGTGTGCAGAGCACTCTCGCCGCCCTGTATCCACCC
TTTGAGGCAACAGCCCCCACCCTGTTGGGCCAGGTGTTCCAGGTGGTGGAGAGGACTTAT
CGGGAGGACGCACTGAGGTACACGCTGGACTTCCTGGTACCAGCCAAGCACCTGCTTGCC
AAGGTCCAGCAGGAAGCCTGTGCCCAATACAGTGGATTCCTCTTCTTCCATGAGGGGTGG
CCGCTCTGCCTGCATGAACAGGTGGTGGTGCAGCTAGCAGCCCTACCCTGGCAACTGCTG
CGCCCAGGAGACTTCTATCTGCAGGTGGTGCCCTCAGCTGCCCAAGCACCCCGACTAGCA
CTCAAGTGTCTGGCCCCTGGGGGTGGGCGGGTGCAGGAGGTTCCTGTGCCCAATGAGGCT
TGTGCCTACCTATTCACACCTGAGTGGCTACAAGGCATCAACAAGGACCGGCCAACAGGT
CGCCTCAGTACCTGCCTACTGTCTGCGCCCTCTGGGATTCAGCGGCTGCCCTGGGCTGAG
CTCATCTGTCCACGATTTGTGCACAAAGAGGGCCTCATGGTTGGACATCAGCCAAGTACA
CTGCCCCCAGAACTGCCCTCTGGACCTCCAGGGCTTCCCAGCCCTCCACTTCCTGAGGAG
GCGCTGGGTACCCGGAGTCCTGGGGATGGGCACAATGCCCCTGTGGAAGGACCTGAGGGC
GAGTATGTGGAGCTGTTAGAGGTGACGCTGCCCGTGAGGGGGAGCCCAACAGATGCTGAA
GGCTCCCCAGGCCTCTCCAGAGTCCGGACGGTACCCACCCGCAAGGGCGCTGGAGGGAAG
GGCCGCCACCGGAGACACCGGGCGTGGATGCACCAGAAGGGCCTGGGGCCTCGGGGCCAG
GATGGAGCACGCCCACCCGGCGAGGGGAGCAGCACCGGAGCCTCCCCTGAGTCTCCCCCA
GGAGCTGAGGCTGTCCCAGAGGCAGCAGTCTTGGAGGTGTCTGAGCCCCCAGCAGAGGCT
GTGGGAGAAGCCTCCGGATCTTGCCCCCTGAGGCCAGGGGAGCTTAGAGGAGGAGGAGGA
GGAGGCCAGGGGGCTGAAGGACCACCTGGTACCCCTCGGAGAACAGGCAAAGGAAACAGA
AGAAAGAAGCGAGCTGCAGGTCGAGGGGCTCTTAGCCGAGGAGGGGACAGTGCCCCACTG
AGCCCTGGGGACAAGGAAGATGCCAGCCACCAAGAAGCCCTTGGCAATCTGCCCTCACCA
AGTGAGCACAAGCTTCCAGAATGCCACCTGGTTAAGGAGGAATATGAAGGCTCAGGGAAG
CCAGAATCTGAGCCAAAAGAGCTCAAAACAGCAGGCGAGAAAGAGCCTCAGCTCTCTGAA
GCCTGTGGGCCTACAGAAGAGGGGGCCGGAGAGAGAGAGCTGGAGGGGCCAGGCCTGCTG
TGTATGGCAGGACACACAGGCCCAGAAGGCCCCCTGTCTGACACTCCAACACCTCCGCTG
GAGACTGTGCAGGAAGGAAAAGGGGACAACATTCCAGAAGAGGCCCTTGCAGTCTCCGTC
TCTGATCACCCTGATGTAGCTTGGGACTTGATGGCATCTGGATTCCTCATCCTGACGGGA
GGGGTGGACCAGAGTGGGCGAGCTCTGCTGACCATTACCCCACCGTGCCCTCCTGAGGAG
CCCCCACCCTCCCGAGACACGCTGAACACAACTCTTCATTACCTCCACTCACTGCTCAGG
CCTGATCTACAGACACTGGGGCTGTCCGTCCTGCTGGACCTTCGTCAGGCACCTCCACTG
CCTCCAGCACTCATTCCTGCCTTGAGCCAACTTCAGGACTCAGGAGATCCTCCCCTTGTT
CAGCGGCTGCTGATTCTCATTCATGATGACCTTCCAACTGAACTCTGTGGATTTCAGGGT
GCTGAGGTGCTGTCAGAGAATGATCTGAAAAGAGTGGCCAAGCCAGAGGAGCTGCAGTGG
GAGTTAGGAGGTCACAGGGACCCCTCTCCCAGTCACTGGGTAGAGATACACCAGGAAGTG
GTAAGGCTATGTCGCCTGTGCCAAGGTGTGCTGGGCTCGGTACGGCAGGCCATTGAGGAG
CTGGAGGGAGCAGCAGAGCCAGAGGAAGAGGAGGCAGTGGGAATGCCCAAGCCACTGCAG
AAGGTGCTGGCAGATCCCCGGCTGACGGCACTGCAGAGGGATGGGGGGGCCATCCTGATG
AGGCTGCGCTCCACTCCCAGCAGCAAGCTGGAGGGCCAAGGCCCAGCTACACTGTATCAG
GAAGTGGACGAGGCCATTCACCAGCTTGTGCGCCTCTCCAACCTGCACGTGCAGCAGCAA
GAGCAGCGGCAGTGCCTGCGGCGACTCCAGCAGGTGTTGCAGTGGCTCTCGGGCCCAGGG
GAGGAGCAGCTGGCAAGCTTTGCTATGCCTGGGGACACCTTGTCTGCCCTGCAGGAGACA
GAGCTGCGATTCCGTGCTTTCAGCGCTGAGGTCCAGGAGCGCCTGGCCCAGGCACGGGAG
GCCCTGGCTCTGGAGGAGAATGCCACCTCCCAGAAGGTGCTGGATATCTTTGAACAGCGG
CTGGAGCAGGTTGAGAGTGGCCTCCATCGGGCCCTGCGGCTACAGCGCTTCTTCCAGCAG
GCACATGAATGGGTGGATGAGGGCTTTGCTCGGCTGGCAGGAGCTGGGCCGGGTCGGGAG
GCTGTGCTGGCTGCACTGGCCCTGCGGCGGGCCCCAGAGCCCAGTGCCGGCACCTTCCAG
GAGATGCGGGCCCTGGCCCTGGACCTGGGCAGCCCAGCAGCCCTGCGAGAATGGGGCCGC
TGCCAGGCCCGCTGCCAAGAGCTAGAGAGGAGGATCCAGCAACACGTGGGAGAGGAGGCG
AGCCCACGGGGCTACCGACGACGGCGGGCAGACGGTGCCAGCAGTGGAGGGGCCCAGTGG
GGGCCCCGCAGCCCCTCGCCCAGCCTCAGCTCCTTGCTGCTCCCCAGCAGCCCTGGGCCA
CGGCCAGCCCCATCCCATTGCTCCCTGGCCCCATGTGGAGAGGACTATGAGGAAGAGGGC
CCTGAGCTGGCTCCAGAAGCAGAGGGCAGGCCCCCAAGAGCTGTGCTGATCCGAGGCCTG
GAGGTCACCAGCACTGAGGTGGTAGACAGGACGTGCTCACCACGGGAACACGTGCTGCTG
GGCCGGGCTAGGGGGCCAGACGGACCCTGGGGAGTAGGCACCCCCCGGATGGAGCGCAAG
CGAAGCATCAGTGCCCAGCAGCGGCTGGTGTCTGAGCTGATTGCCTGTGAACAAGATTAC
GTGGCCACCTTGAGTGAGCCAGTGCCACCCCCTGGGCCTGAGCTGACGCCTGAACTTCGG
GGCACCTGGGCTGCTGCCCTGAGTGCCCGGGAAAGGCTTCGCAGCTTCCACCGGACACAC
TTTCTGCGGGAGCTTCAGGGCTGCGCCACCCACCCCCTACGCATTGGGGCCTGCTTCCTT
CGCCACGGGGACCAGTTCAGCCTTTATGCACAGTACGTGAAGCACCGACACAAACTGGAG
AATGGTCTGGCTGCGCTCAGTCCCTTAAGCAAGGGCTCCATGGAGGCTGGCCCTTACCTG
CCCCGAGCCCTGCAGCAGCCTCTGGAACAGCTGACTCGGTATGGGCGGCTCCTGGAGGAG
CTCCTGAGGGAAGCTGGGCCTGAGCTCAGTTCTGAGTGCCGGGCCCTTGGGGCTGCTGTA
CAGCTGCTCCGGGAACAAGAGGCCCGTGGCAGAGACCTGCTGGCCGTGGAGGCGGTGCGT
GGCTGTGAGATAGATCTGAAGGAGCAGGGACAGCTCTTGCATCGAGACCCCTTCACTGTC
ATCTGTGGCCGAAAGAAGTGCCTTCGCCATGTCTTTCTCTTCGAGCATCTCCTCCTGTTC
AGCAAGCTCAAGGGCCCTGAAGGGGGGTCAGAGATGTTTGTTTACAAGCAGGCCTTTAAG
ACTGCTGATATGGGGCTGACAGAAAACATCGGGGACAGCGGACTCTGCTTTGAGTTGTGG
TTTCGGCGGCGGCGTGCACGAGAGGCATACACTCTGCAGGCAACCTCACCAGAGATCAAA
CTCAAGTGGACAAGTTCTATTGCCCAGCTGCTGTGGAGACAGGCAGCCCACAACAAGGAG
CTCCGAGTGCAGCAGATGGTGTCCATGGGCATTGGGAATAAACCCTTCCTGGACATCAAA
GCCCTTGGGGAGCGGACGCTGAGTGCCCTGCTCACTGGAAGAGCCGCCCGCACCCGGGCC
TCCGTGGCCGTGTCATCCTTTGAGCATGCCGGCCCCTCCCTTCCCGGCCTTTCGCCGGGA
GCCTGCTCCCTGCCTGCCCGCGTCGAGGAGGAGGCCTGGGATCTGGACGTCAAGCAAATT
TCCCTGGCCCCAGAAACACTTGACTCTTCTGGAGATGTGTCCCCAGGACCAAGAAACAGC
CCCAGCCTGCAACCCCCCCACCCTGGGAGCAGCACTCCCACCCTGGCCAGTCGAGGGATC
TTAGGGCTATCCCGACAGAGTCATGCTCGAGCCCTGAGTGACCCCACCACGCCTCTGTGA
Protein Properties
Number of Residues 1519
Molecular Weight 164656.0
Theoretical pI 6.07
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Protein SOLO
MEPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYREDALRYTLDFLVPAKHLLA
KVQQEACAQYSGFLFFHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVVPSAAQAPRLA
LKCLAPGGGRVQEVPVPNEACAYLFTPEWLQGINKDRPTGRLSTCLLSAPSGIQRLPWAE
LICPRFVHKEGLMVGHQPSTLPPELPSGPPGLPSPPLPEEALGTRSPGDGHNAPVEGPEG
EYVELLEVTLPVRGSPTDAEGSPGLSRVRTVPTRKGAGGKGRHRRHRAWMHQKGLGPRGQ
DGARPPGEGSSTGASPESPPGAEAVPEAAVLEVSEPPAEAVGEASGSCPLRPGELRGGGG
GGQGAEGPPGTPRRTGKGNRRKKRAAGRGALSRGGDSAPLSPGDKEDASHQEALGNLPSP
SEHKLPECHLVKEEYEGSGKPESEPKELKTAGEKEPQLSEACGPTEEGAGERELEGPGLL
CMAGHTGPEGPLSDTPTPPLETVQEGKGDNIPEEALAVSVSDHPDVAWDLMASGFLILTG
GVDQSGRALLTITPPCPPEEPPPSRDTLNTTLHYLHSLLRPDLQTLGLSVLLDLRQAPPL
PPALIPALSQLQDSGDPPLVQRLLILIHDDLPTELCGFQGAEVLSENDLKRVAKPEELQW
ELGGHRDPSPSHWVEIHQEVVRLCRLCQGVLGSVRQAIEELEGAAEPEEEEAVGMPKPLQ
KVLADPRLTALQRDGGAILMRLRSTPSSKLEGQGPATLYQEVDEAIHQLVRLSNLHVQQQ
EQRQCLRRLQQVLQWLSGPGEEQLASFAMPGDTLSALQETELRFRAFSAEVQERLAQARE
ALALEENATSQKVLDIFEQRLEQVESGLHRALRLQRFFQQAHEWVDEGFARLAGAGPGRE
AVLAALALRRAPEPSAGTFQEMRALALDLGSPAALREWGRCQARCQELERRIQQHVGEEA
SPRGYRRRRADGASSGGAQWGPRSPSPSLSSLLLPSSPGPRPAPSHCSLAPCGEDYEEEG
PELAPEAEGRPPRAVLIRGLEVTSTEVVDRTCSPREHVLLGRARGPDGPWGVGTPRMERK
RSISAQQRLVSELIACEQDYVATLSEPVPPPGPELTPELRGTWAAALSARERLRSFHRTH
FLRELQGCATHPLRIGACFLRHGDQFSLYAQYVKHRHKLENGLAALSPLSKGSMEAGPYL
PRALQQPLEQLTRYGRLLEELLREAGPELSSECRALGAAVQLLREQEARGRDLLAVEAVR
GCEIDLKEQGQLLHRDPFTVICGRKKCLRHVFLFEHLLLFSKLKGPEGGSEMFVYKQAFK
TADMGLTENIGDSGLCFELWFRRRRAREAYTLQATSPEIKLKWTSSIAQLLWRQAAHNKE
LRVQQMVSMGIGNKPFLDIKALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPGLSPG
ACSLPARVEEEAWDLDVKQISLAPETLDSSGDVSPGPRNSPSLQPPHPGSSTPTLASRGI
LGLSRQSHARALSDPTTPL
GenBank ID Protein 50843837
UniProtKB/Swiss-Prot ID Q8TER5
UniProtKB/Swiss-Prot Entry Name SOLO_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_018071.3
GeneCard ID SOLO
GenAtlas ID ARHGEF40
HGNC ID HGNC:25516
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  7. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  8. Tse SW, Broderick JA, Wei ML, Luo MH, Smith D, McCaffery P, Stamm S, Andreadis A: Identification, expression analysis, genomic organization and cellular location of a novel protein with a RhoGEF domain. Gene. 2005 Oct 10;359:63-72. [PubMed:16143467 ]