Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11493
Secondary Accession Numbers
  • 17844
Name Rho guanine nucleotide exchange factor 4
Synonyms
  1. APC-stimulated guanine nucleotide exchange factor
  2. Asef
Gene Name ARHGEF4
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Acts as guanine nucleotide exchange factor (GEF) for RhoA and RAC1 GTPases. Binding of APC may activate RAC1 GEF activity. The APC-ARHGEF4 complex seems to be involved in cell migration as well as in E-cadherin-mediated cell-cell adhesion
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
intracellular signaling pathway
signaling
signaling pathway
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Peripheral membrane protein
  2. Cell projection
  3. Isoform 3:Cytoplasm
  4. Cytoplasmic side (Probable)
  5. ruffle membrane
Gene Properties
Chromosome Location Chromosome:2
Locus 2q22
SNPs ARHGEF4
Gene Sequence
>2073 bp
ATGCCCTGGGAAGAACCAGCAGGTGAGAAGCCCAGTTGCTCTCACAGTCAGAAGGCGTTC
CACATGGAGCCTGCCCAGAAGCCCTGCTTCACCACTGACATGGTGACATGGGCCCTCCTC
TGCATCTCTGCAGAGACTGTGCGTGGGGAGGCTCCTTCACAGCCTAGGGGCATCCCTCAC
CGCTCGCCCGTCAGTGTGGATGACCTGTGGCTGGAGAAGACACAGAGAAAGAAGTTGCAG
AAGCAGGCCCACGTCGAAAGGAGGCTGCACATAGGGGCAGTGCACAAAGATGGAGTCAAG
TGCTGGAGAAAGACGATCATTACCTCTCCAGAGTCTTTGAATCTCCCTAGAAGAAGCCAT
CCACTCTCCCAGAGTGCTCCAACGGGACTGAACCACATGGGCTGGCCAGAGCACACACCA
GGCACTGCCATGCCTGATGGAGCTCTGGACACAGCTGTCTGCGCTGACGAAGTGGGGAGC
GAGGAGGACCTGTATGATGACCTGCACAGCTCCAGCCACCACTACAGCCACCCTGGAGGG
GGTGGGGAGCAGCTGGCTATCAATGAGCTCATCAGCGATGGCAGTGTGGTCTGCGCTGAA
GCACTCTGGGACCATGTCACCATGGACGACCAGGAGCTGGGCTTCAAAGCTGGGGACGTC
ATCGAAGTGATGGATGCCACCAACAGAGAGTGGTGGTGGGGCCGGGTCGCCGATGGCGAG
GGCTGGTTTCCAGCCAGCTTCGTTCGGCTGAGGGTGAATCAGGACGAGCCCGCGGATGAC
GACGCCCCTCTGGCCGGGAACAGCGGAGCGGAGGACGGCGGGGCGGAGGCGCAGAGCAGC
AAGGACCAGATGCGGACCAACGTCATCAACGAGATCCTCAGCACTGAGCGGGACTACATC
AAGCACCTGCGCGACATCTGCGAGGGCTACGTCCGGCAGTGCCGCAAGCGCGCAGACATG
TTCAGCGAGGAGCAGCTGCGTACCATCTTCGGGAACATCGAGGACATCTACCGCTGCCAG
AAGGCCTTCGTGAAGGCCCTGGAGCAGAGGTTCAACCGCGAGCGCCCACACCTGAGCGAG
CTGGGTGCCTGCTTCCTGGAGCATCAAGCCGACTTCCAGATCTACTCGGAGTACTGCAAT
AACCACCCCAACGCCTGCGTGGAGCTCTCCCGGCTCACCAAGCTCAGCAAGTACGTGTAC
TTCTTCGAGGCCTGCCGGCTGCTGCAGAAGATGATTGACATCTCCCTGGATGGCTTCCTG
CTGACTCCGGTGCAGAAGATCTGCAAGTACCCTCTGCAGCTGGCCGAGCTGCTCAAATAC
ACGCACCCCCAGCACAGGGACTTCAAGGATGTTGAAGCCGCCTTGCATGCCATGAAGAAC
GTGGCCCAGCTCATCAACGAGCGGAAGCGGAGACTTGAGAACATCGACAAGATTGCTCAG
TGGCAGAGCTCCATAGAGGACTGGGAGGGAGAAGATCTCTTGGTCAGGAGCTCAGAACTC
ATCTACTCGGGGGAGCTGACTCGAGTTACACAGCCTCAAGCCAAAAGCCAGCAGCGAATG
TTCTTTCTCTTTGACCACCAGCTCATCTACTGTAAGAAGGACCTGCTCCGCCGCGACGTG
TTGTACTACAAGGGCCGGCTGGACATGGACGGCCTGGAGGTGGTGGACCTGGAGGACGGG
AAGGACAGAGACCTCCATGTGAGCATCAAGAACGCCTTCCGGCTGCACCGTGGCGCCACA
GGGGACAGCCACCTGCTGTGCACCAGGAAGCCCGAGCAGAAGCAGCGCTGGCTCAAGGCC
TTTGCCAGGGAGAGGGAGCAGGTGCAGCTGGACCAGGAGACAGGCTTCTCCATCACTGAA
CTGCAGAGGAAGCAGGCCATGCTGAATGCCAGCAAGCAGCAGGTCACAGGGAAGCCCAAA
GCTGTTGGCCGGCCCTGCTACCTGACGCGCCAGAAGCACCCAGCCCTGCCCAGCAACCGG
CCCCAGCAGCAGGTCCTGGTGCTGGCGGAGCCCAGGCGCAAGCCATCTACCTTCTGGCAC
AGCATCAGCCGGCTGGCACCCTTCCGCAAGTGA
Protein Properties
Number of Residues 690
Molecular Weight 79065.9
Theoretical pI 7.0
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho guanine nucleotide exchange factor 4
MPWEEPAGEKPSCSHSQKAFHMEPAQKPCFTTDMVTWALLCISAETVRGEAPSQPRGIPH
RSPVSVDDLWLEKTQRKKLQKQAHVERRLHIGAVHKDGVKCWRKTIITSPESLNLPRRSH
PLSQSAPTGLNHMGWPEHTPGTAMPDGALDTAVCADEVGSEEDLYDDLHSSSHHYSHPGG
GGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGE
GWFPASFVRLRVNQDEPADDDAPLAGNSGAEDGGAEAQSSKDQMRTNVINEILSTERDYI
KHLRDICEGYVRQCRKRADMFSEEQLRTIFGNIEDIYRCQKAFVKALEQRFNRERPHLSE
LGACFLEHQADFQIYSEYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKMIDISLDGFL
LTPVQKICKYPLQLAELLKYTHPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQ
WQSSIEDWEGEDLLVRSSELIYSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDV
LYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKA
FAREREQVQLDQETGFSITELQRKQAMLNASKQQVTGKPKAVGRPCYLTRQKHPALPSNR
PQQQVLVLAEPRRKPSTFWHSISRLAPFRK
GenBank ID Protein 15011979
UniProtKB/Swiss-Prot ID Q9NR80
UniProtKB/Swiss-Prot Entry Name ARHG4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015320.2
GeneCard ID ARHGEF4
GenAtlas ID ARHGEF4
HGNC ID HGNC:684
References
General References
  1. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Kikuno R, Nagase T, Ishikawa K, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Jun 30;6(3):197-205. [PubMed:10470851 ]
  4. Thiesen S, Kubart S, Ropers HH, Nothwang HG: Isolation of two novel human RhoGEFs, ARHGEF3 and ARHGEF4, in 3p13-21 and 2q22. Biochem Biophys Res Commun. 2000 Jun 24;273(1):364-9. [PubMed:10873612 ]
  5. Kawasaki Y, Senda T, Ishidate T, Koyama R, Morishita T, Iwayama Y, Higuchi O, Akiyama T: Asef, a link between the tumor suppressor APC and G-protein signaling. Science. 2000 Aug 18;289(5482):1194-7. [PubMed:10947987 ]
  6. Kawasaki Y, Sato R, Akiyama T: Mutated APC and Asef are involved in the migration of colorectal tumour cells. Nat Cell Biol. 2003 Mar;5(3):211-5. [PubMed:12598901 ]