Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11495
Secondary Accession Numbers
  • 17849
Name Engulfment and cell motility protein 1
Synonyms
  1. Protein ced-12 homolog
Gene Name ELMO1
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in assocation with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1
Pathways Not Available
Reactions Not Available
GO Classification
Component
cytoskeleton
organelle
non-membrane-bounded organelle
intracellular non-membrane-bounded organelle
Function
binding
Process
cellular process
cellular membrane organization
membrane invagination
endocytosis
phagocytosis
Cellular Location
  1. Cell membrane
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:7
Locus 7p14.1
SNPs ELMO1
Gene Sequence
>2184 bp
ATGCCGCCACCCGCGGACATCGTCAAGGTGGCCATAGAATGGCCGGGCGCCTACCCCAAA
CTCATGGAAATTGATCAGAAAAAACCACTGTCTGCAATAATAAAGGAAGTCTGTGATGGG
TGGTCTCTTGCCAACCATGAATATTTTGCACTCCAGCATGCCGATAGTTCAAACTTCTAT
ATCACAGAAAAGAACCGCAATGAGATAAAAAATGGCACTATCCTTCGATTAACCACATCT
CCAGCTCAGAACGCCCAGCAGCTCCATGAACGAATCCAGTCCTCGAGTATGGATGCCAAG
CTGGAAGCCCTGAAGGACTTGGCCAGCCTCTCCCGGGATGTCACGTTTGCCCAGGAGTTT
ATAAACCTGGACGGTATCTCTCTCCTCACGCAGATGGTGGAGAGCGGCACTGAGCGATAC
CAGAAATTGCAGAAGATCATGAAGCCTTGCTTTGGAGACATGCTGTCCTTCACCCTGACG
GCCTTCGTCGAGCTGATGGACCATGGCATAGTGTCCTGGGATACATTTTCGGTGGCGTTC
ATTAAGAAGATAGCAAGTTTTGTGAACAAGTCAGCCATAGACATCTCGATCCTGCAGCGG
TCCTTGGCCATTTTGGAGTCGATGGTGCTCAATAGCCATGATCTCTACCAGAAAGTGGCG
CAGGAGATCACCATCGGCCAGCTCATTCCACACCTGCAAGGGTCAGATCAAGAAATCCAA
ACCTATACTATTGCAGTGATTAATGCGCTTTTCCTGAAGGCTCCTGATGAGAGGAGGCAG
GAGATGGCGAATATTTTGGCTCAGAAGCAACTGCGTTCCATCATTTTAACACATGTCATC
CGAGCCCAGCGGGCCATCAACAATGAGATGGCGCACCAGCTGTATGTTCTACAAGTGCTC
ACCTTTAACCTCCTGGAAGACAGGATGATGACCAAAATGGACCCCCAGGACCAGGCTCAG
AGGGACATCATATTTGAACTTCGAAGAATTGCTTTTGATGCTGAGTCTGAACCTAACAAC
AGCAGTGGCAGCATGGAGAAACGCAAGTCCATGTACACGCGAGATTATAAGAAGCTTGGG
TTCATTAATCATGTCAACCCTGCCATGGACTTCACGCAGACTCCACCTGGGATGTTGGCT
CTGGACAACATGCTGTACTTTGCCAAGCACCACCAAGATGCCTACATCCGGATTGTGCTT
GAGAACAGTAGTCGAGAAGACAAGCATGAATGTCCCTTTGGCCGCAGTAGTATAGAGCTG
ACCAAGATGCTATGTGAGATCTTGAAAGTGGGCGAGTTGCCTAGTGAGACCTGCAACGAC
TTCCACCCGATGTTCTTCACCCACGACAGATCCTTTGAGGAGTTTTTCTGCATCTGTATC
CAGCTCCTGAACAAGACATGGAAGGAAATGAGGGCAACTTCTGAAGACTTCAACAAGGTA
ATGCAGGTGGTGAAGGAGCAGGTTATGAGAGCACTTACAACCAAGCCTAGCTCCCTGGAC
CAGTTCAAGAGCAAACTGCAGAACCTGAGCTACACTGAGATCCTGAAAATCCGCCAGTCC
GAGAGGATGAACCAGGAAGATTTCCAGTCCCGCCCGATTTTGGAACTAAAGGAGAAGATT
CAGCCAGAAATCTTAGAGCTGATCAAACAGCAACGCCTGAACCGCCTTGTGGAAGGGACC
TGCTTTAGGAAACTCAATGCCCGGCGGAGGCAAGACAAGTTTTGGTATTGTCGGCTTTCG
CCAAATCACAAAGTCCTGCATTACGGAGACTTAGAAGAGAGTCCTCAGGGAGAAGTGCCC
CACGATTCCTTGCAGGACAAACTGCCGGTGGCAGATATCAAAGCCGTGGTGACGGGAAAG
GACTGCCCTCATATGAAAGAGAAAGGTGCCCTTAAACAAAACAAGGAGGTGCTTGAACTC
GCTTTCTCCATCTTGTATGACTCAAACTGCCAACTGAACTTCATCGCTCCTGACAAGCAT
GAGTACTGTATCTGGACGGATGGACTGAATGCGCTACTCGGGAAGGACATGATGAGCGAC
CTGACGCGGAATGACCTGGACACCCTGCTCAGCATGGAAATCAAGCTCCGCCTCCTGGAC
CTGGAAAACATCCAGATCCCTGACGCACCTCCGCCGATTCCCAAGGAGCCCAGCAACTAT
GACTTCGTCTATGACTGTAACTGA
Protein Properties
Number of Residues 727
Molecular Weight 83828.6
Theoretical pI 6.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Engulfment and cell motility protein 1
MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFY
ITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEF
INLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAF
IKKIASFVNKSAIDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGSDQEIQ
TYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVIRAQRAINNEMAHQLYVLQVL
TFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKSMYTRDYKKLG
FINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL
TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKV
MQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKI
QPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKH
EYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNY
DFVYDCN
GenBank ID Protein 16118555
UniProtKB/Swiss-Prot ID Q92556
UniProtKB/Swiss-Prot Entry Name ELMO1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF398885
GeneCard ID ELMO1
GenAtlas ID ELMO1
HGNC ID HGNC:16286
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  6. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205 ]
  7. Brugnera E, Haney L, Grimsley C, Lu M, Walk SF, Tosello-Trampont AC, Macara IG, Madhani H, Fink GR, Ravichandran KS: Unconventional Rac-GEF activity is mediated through the Dock180-ELMO complex. Nat Cell Biol. 2002 Aug;4(8):574-82. [PubMed:12134158 ]
  8. Ohara O, Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Nomura N: Construction and characterization of human brain cDNA libraries suitable for analysis of cDNA clones encoding relatively large proteins. DNA Res. 1997 Feb 28;4(1):53-9. [PubMed:9179496 ]
  9. D'Angelo R, Aresta S, Blangy A, Del Maestro L, Louvard D, Arpin M: Interaction of ezrin with the novel guanine nucleotide exchange factor PLEKHG6 promotes RhoG-dependent apical cytoskeleton rearrangements in epithelial cells. Mol Biol Cell. 2007 Dec;18(12):4780-93. Epub 2007 Sep 19. [PubMed:17881735 ]
  10. Gumienny TL, Brugnera E, Tosello-Trampont AC, Kinchen JM, Haney LB, Nishiwaki K, Walk SF, Nemergut ME, Macara IG, Francis R, Schedl T, Qin Y, Van Aelst L, Hengartner MO, Ravichandran KS: CED-12/ELMO, a novel member of the CrkII/Dock180/Rac pathway, is required for phagocytosis and cell migration. Cell. 2001 Oct 5;107(1):27-41. [PubMed:11595183 ]
  11. Scott MP, Zappacosta F, Kim EY, Annan RS, Miller WT: Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1. J Biol Chem. 2002 Aug 2;277(31):28238-46. Epub 2002 May 23. [PubMed:12029088 ]