Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11505
Secondary Accession Numbers
  • 17859
Name Rho guanine nucleotide exchange factor 17
Synonyms
  1. 164 kDa Rho-specific guanine-nucleotide exchange factor
  2. Tumor endothelial marker 4
  3. p164-RhoGEF
  4. p164RhoGEF
Gene Name ARHGEF17
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPases
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.4
SNPs ARHGEF17
Gene Sequence
>6192 bp
ATGGCGGACGGGGCACCCCGGCCCCAGCTTTACCGCAGCGTCTCGTTCAAGCTGCTGGAG
CGCTGGAGCGGCGGCCCCGGGCTGAGGGAGGAGGACACGGACACCCCCGGCTTGAGGCGA
CGCGCCTCGTGCCGGCCGACCACGGCTGCCCGGGGCCAGCCCTCTCGGCGCGTGTCCAAG
CTGGCGTCTGGGCCCCTGGCCGCCCCCGCGCAGCCGCGCCCGCTCCGCAGCCTCTCGCCG
TCGGTTCGCCAGCTCTCCCGGCGCTTCGACGCGCCGCGTCTGGACGACGGCTCCGCTGGG
ACCCGAGACGGAGGCGTCTTACCCGCGGCCGCGGAAGAAGCGGCCGAGGGCCCAGCGCGA
GGAGCCTGGCCCAGCGTCACCGAGATGCGCAAGCTCTTCGGCGGTCCTGGCTCCAGGAGG
CCCAGCGCCGACTCTGAATCCCCAGGAACGCCCAGCCCCGACGGTGCCGCGTGGGAGCCT
CCGGCTCGGGAGTCGCGGCAGCCACCGACGCCACCCCCTCGGACATGCTTCCCCCTGGCG
GGTCTGCGTTCGGCGCGGCCCCTGACCGGGCCGGAGACCGAAGGGAGGCTGCGCCGGCCG
CAGCAGCAACAGGAGCGGGCGCAGCGTCCAGCGGATGGTTTACATTCTTGGCATATCTTC
TCCCAACCGCAGGCCGGGGCCCGGGCCTCCTGCTCCTCCTCCTCCATCGCCGCCTCCTAT
CCTGTCAGCCGCAGTCGTGCTGCCAGCTCCAGCGAGGAGGAAGAGGAGGGCCCGCCGCAG
CTGCCTGGAGCCCAGAGTCCGGCCTACCACGGCGGCCACTCCTCGGGCAGTGACGACGAC
CGAGACGGTGAGGGCGGCCACCGCTGGGGAGGGAGGCCCGGGCTCAGGCCTGGAAGCTCC
CTATTGGATCAGGACTGCAGGCCTGACAGTGATGGGTTAAATCTAAGCAGCATGAACTCA
GCAGGGGTTTCTGGGAGCCCTGAGCCCCCAACATCTCCAAGAGCCCCTAGAGAAGAAGGA
CTCCGGGAGTGGGGTAGTGGCTCTCCGCCCTGCGTCCCAGGTCCCCAGGAGGGACTTCGG
CCTATGTCTGACTCTGTGGGAGGAGCTTTCCGTGTGGCCAAGGTGAGCTTTCCCTCGTAC
CTGGCCAGCCCCGCAGGCTCCCGCGGTAGCAGCCGTTATTCCAGCACGGAGACCCTCAAG
GACGACGACCTATGGTCTAGTAGGGGTTCTGGGGGCTGGGGCGTGTACCGCTCCCCTAGC
TTTGGAGCTGGGGAAGGGCTCCTGCGGTCCCAGGCTCGAACCCGTGCCAAAGGACCTGGA
GGCACCTCTAGGGCATTGAGGGATGGAGGATTTGAGCCTGAAAAGAGTCGACAGCGGAAG
TCCCTGTCAAATCCAGATATCGCCTCAGAGACCCTGACGCTTCTCAGTTTCCTGCGCTCA
GACCTTTCAGAGCTGAGGGTCCGAAAACCTGGTGGGAGCTCCGGGGACCGTGGAAGCAAC
CCCCTAGATGGCAGAGACTCACCATCCGCAGGTGGCCCTGTGGGGCAACTTGAACCCATA
CCCATCCCAGCCCCAGCATCACCTGGCACGCGCCCCACACTCAAGGACTTGACAGCCACT
CTGCGGAGAGCAAAGTCATTCACCTGCTCTGAGAAGCCCATGGCCCGCCGCCTGCCCCGC
ACCAGTGCTCTGAAGTCCAGCTCCTCCGAGCTCCTGCTCACAGGCCCTGGTGCCGAGGAG
GATCCGCTGCCCCTCATCGTCCAGGACCAATATGTGCAGGAGGCCCGCCAGGTTTTTGAG
AAGATCCAGCGCATGGGTGCCCAACAAGATGATGGAAGCGATGCCCCCCCTGGAAGCCCT
GACTGGGCAGGGGATGTGACCCGAGGGCAGCGGTCCCAGGAGGAGCTCTCAGGCCCTGAG
TCCAGTCTGACAGATGAAGGCATTGGGGCAGACCCTGAGCCTCCTGTTGCAGCATTTTGC
GGCCTGGGTACCACAGGGATGTGGCGACCTCTTTCCTCATCCTCGGCCCAGACGAACCAC
CATGGCCCTGGGACTGAGGACAGTCTGGGCGGGTGGGCCCTGGTGTCGCCTGAGACCCCT
CCCACACCAGGTGCCCTCCGCCGACGACGCAAAGTCCCACCTTCAGGTTCTGGTGGGAGC
GAATTGAGCAATGGGGAGGCAGGGGAGGCCTACAGGTCCCTGAGTGACCCAATTCCTCAG
CGCCACCGGGCTGCCACCTCTGAAGAGCCTACTGGGTTCTCTGTGGACAGCAACCTCCTG
GGCTCACTGAGCCCCAAGACAGGGCTCCCTGCCACCTCAGCCATGGATGAGGGCTTGACC
AGTGGTCACAGTGACTGGTCTGTGGGCAGTGAAGAGAGCAAGGGATATCAGGAGGTTATT
CAGAGCATAGTTCAGGGGCCTGGCACCCTGGGGCGTGTGGTGGACGACAGGATTGCTGGC
AAAGCCCCCAAGAAGAAATCCCTGAGTGACCCCAGCCGCCGTGGGGAGCTGGCTGGGCCT
GGATTCGAGGGCCCTGGAGGGGAGCCCATCCGAGAAGTTGAGCCCATGCTGCCTCCATCC
AGCAGCGAGCCCATCCTTGTAGAGCAGCGGGCAGAGCCAGAAGAACCTGGTGCCACCAGG
AGCCGGGCACAGTCTGAAAGGGCCCTACCTGAGGCTCTGCCTCCCCCTGCCACTGCCCAC
CGAAACTTTCACCTTGACCCCAAGCTGGCTGACATTCTGTCCCCGAGGCTAATCCGCCGA
GGCTCCAAGAAGCGCCCAGCTCGGAGTAGTCACCAGGAGCTTCGGAGAGACGAGGGCAGT
CAGGACCAGACTGGCAGCCTGTCTCGGGCCCGGCCCTCCTCCAGACACGTTCGCCATGCC
AGTGTGCCCGCCACATTTATGCCTATTGTGGTGCCTGAGCCACCAACTTCTGTTGGTCCC
CCTGTGGCTGTGCCAGAACCCATAGGCTTCCCTACCCGAGCCCATCCCACGTTGCAGGCA
CCATCGCTCGAGGACGTCACCAAGCAGTACATGCTGAACCTGCACTCCGGTGAGGTCCCT
GCCCCAGTGCCAGTGGACATGCCCTGCTTGCCTCTGGCTGCACCGCCCTCTGCTGAGGCC
AAGCCCCCTGAGGCAGCTCGGCCTGCAGATGAGCCTACCCCTGCCAGCAAGTGCTGCAGC
AAGCCACAGGTGGACATGCGGAAGCACGTGGCCATGACCCTGCTGGACACAGAGCAGTCG
TATGTGGAGTCGCTGCGCACCCTGATGCAGGGCTACATGCAGCCGCTGAAGCAGCCAGAG
AACTCCGTGCTCTGTGACCCTTCACTGGTGGACGAGATCTTCGACCAGATCCCCGAGCTC
CTGGAGCACCACGAGCAATTCCTGGAGCAGGTTCGGCACTGCATGCAGACCTGGCATGCC
CAGCAGAAGGTGGGAGCCCTGCTCGTCCAGTCGTTCTCCAAGGATGTCCTAGTAAACATC
TATTCTGCCTATATCGATAACTTCCTCAATGCAAAGGATGCTGTGCGTGTGGCCAAGGAG
GCGAGGCCTGCCTTTCTCAAGTTCCTAGAGCAAAGCATGCGTGAGAACAAGGAGAAGCAG
GCGCTGTCTGACCTCATGATCAAGCCTGTGCAGCGGATCCCACGCTACGAGCTTCTGGTG
AAGGACCTCCTGAAGCATACACCTGAGGACCACCCGGACCATCCACTCCTGCTGGAGGCG
CAGCGGAACATCAAGCAGGTGGCTGAGCGCATCAACAAGGGTGTGCGGAGTGCCGAGGAG
GCGGAGCGCCATGCCCGTGTGCTGCAGGAGATAGAGGCTCACATCGAGGGCATGGAGGAT
CTCCAGGCCCCTCTGCGGCGGTTCCTGAGACAGGAGATGGTCATTGAAGTGAAGGCGATC
GGTGGCAAGAAGGACCGGTCTCTCTTCCTGTTCACGGACCTCATCGTCTGCACCACTCTG
AAGCGAAAGTCAGGCTCCCTGCGGCGCAGCTCCATGAGCCTGTACACGGCAGCCAGTGTC
ATTGACACAGCCAGCAAGTACAAGATGCTGTGGAAGCTGCCGCTGGAAGACGCAGACATC
ATCAAAGGGGCATCCCAAGCCACCAATCGGGAGAACATCCAGAAGGCCATCAGCCGCCTT
GATGAGGACCTCACCACCCTGGGCCAAATGAGCAAGCTCTCTGAGAGCCTTGGTTTCCCC
CACCAGAGCCTGGACGATGCACTGCGGGACCTCTCAGCTGCCATGCACCGGGACCTGTCG
GAGAAGCAGGCGCTGTGCTACGCGCTTTCCTTCCCGCCAACCAAGCTGGAGCTGTGCGCC
ACTCGGCCCGAGGGCACCGACTCCTACATTTTTGAGTTCCCTCACCCTGACGCCCGCCTT
GGTTTTGAACAGGCCTTCGATGAGGCCAAGAGGAAGCTGGCATCCAGCAAAAGCTGTCTA
GACCCTGAGTTCCTGAAGGCCATCCCCATCATGAAAACCCGCAGTGGCATGCAGTTCTCC
TGTGCGGCTCCCACCCTGAACAGCTGCCCGGAGCCCTCGCCTGAGGTATGGGTCTGCAAC
AGCGACGGCTACGTGGGCCAGGTGTGCCTGCTGAGCCTGCGCGCCGAGCCGGACGTGGAG
GCCTGCATCGCCGTCTGTTCCGCCCGCATCCTCTGCATCGGGGCGGTGCCCGGGCTGCAG
CCTCGCTGCCACCGGGAGCCTCCTCCGTCGCTGAGGAGTCCTCCAGAGACGGCACCGGAG
CCCGCCGGGCCGGAGCTGGACGTCGAGGCCGCTGCAGACGAGGAAGCCGCGACGCTCGCG
GAGCCGGGGCCGCAGCCCTGCCTTCACATCTCCATTGCAGGCTCGGGCTTGGAGATGACG
CCGGGCCTCGGCGAGGGTGACCCCCGCCCAGAGCTGGTGCCCTTTGACAGTGACTCTGAC
GATGAGTCTTCGCCCAGCCCCTCGGGGACGCTGCAGAGCCAGGCCAGCCGGTCCACCATC
TCCTCCAGCTTTGGCAATGAGGAGACCCCGAGTTCCAAGGAGGCCACGGCAGAGACCACC
AGCTCAGAGGAGGAGCAGGAGCCAGGCTTCCTGCCACTGTCTGGCTCCTTTGGGCCTGGT
GGTCCCTGCGGCACCAGCCCAATGGATGGGAGAGCCCTTCGCCGCTCCAGCCACGGCTCC
TTCACCCGGGGCAGCCTTGAGGACCTGCTGAGTGTCGACCCTGAGGCCTACCAGAGCTCC
GTGTGGCTGGGCACTGAGGATGGCTGTGTCCACGTGTACCAGTCCTCCGACAGCATCCGT
GACCGCAGGAACAGCATGAAGCTCCAGCATGCGGCCTCTGTGACCTGCATCTTGTATCTG
AATAACCAGGTGTTTGTGTCTCTGGCCAATGGAGAGCTTGTGGTCTACCAAAGGGAAGCA
GGCCATTTCTGGGACCCCCAGAACTTCAAATCAGTGACCTTGGGCACCCAGGGGAGCCCC
ATCACCAAGATGGTATCTGTGGGTGGGCGGCTGTGGTGTGGCTGCCAGAACCGAGTCCTT
GTCCTGAGCCCTGACACGCTGCAGCTGGAGCACATGTTTTACGTGGGTCAGGATTCAAGC
CGCTGCGTGGCTTGCATGGTGGACTCCAGCCTGGGTGTGTGGGTGACATTGAAAGGTAGT
GCCCACGTGTGTCTCTACCATCCAGACACCTTTGAGCAGCTGGCAGAAGTAGACGTCACT
CCTCCCGTGCACAGGATGCTGGCAGGCTCGGATGCCATCATCCGGCAGCACAAGGCTGCC
TGTCTGCGAATCACAGCGCTGCTGGTGTGTGAGGAGCTGCTGTGGGTGGGCACCAGTGCT
GGTGTCGTCCTCACCATGCCCACTTCGCCCGGTACTGTCAGCTGCCCACGGGCACCACTC
AGTCCCACAGGCCTCGGCCAGGGACACACCGGCCACGTCCGCTTCTTGGCTGCAGTCCAG
CTGCCAGATGGCTTCAACCTGCTCTGCCCAACCCCACCACCTCCCCCAGACACAGGCCCC
GAGAAGCTGCCATCACTGGAGCACCGGGACTCCCCTTGGCACCGAGGCCCCGCCCCTGCC
AGGCCTAAAATGCTGGTTATCAGTGGAGGTGATGGCTATGAGGACTTCCGACTCAGCAGT
GGGGGCGGCAGCAGCAGTGAGACTGTGGGTCGAGACGACAGCACAAACCACCTCCTCCTG
TGGAGGGTGTGA
Protein Properties
Number of Residues 2063
Molecular Weight 221670.1
Theoretical pI 6.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho guanine nucleotide exchange factor 17
MADGAPRPQLYRSVSFKLLERWSGGPGLREEDTDTPGLRRRASCRPTTAARGQPSRRVSK
LASGPLAAPAQPRPLRSLSPSVRQLSRRFDAPRLDDGSAGTRDGGVLPAAAEEAAEGPAR
GAWPSVTEMRKLFGGPGSRRPSADSESPGTPSPDGAAWEPPARESRQPPTPPPRTCFPLA
GLRSARPLTGPETEGRLRRPQQQQERAQRPADGLHSWHIFSQPQAGARASCSSSSIAASY
PVSRSRAASSSEEEEEGPPQLPGAQSPAYHGGHSSGSDDDRDGEGGHRWGGRPGLRPGSS
LLDQDCRPDSDGLNLSSMNSAGVSGSPEPPTSPRAPREEGLREWGSGSPPCVPGPQEGLR
PMSDSVGGAFRVAKVSFPSYLASPAGSRGSSRYSSTETLKDDDLWSSRGSGGWGVYRSPS
FGAGEGLLRSQARTRAKGPGGTSRALRDGGFEPEKSRQRKSLSNPDIASETLTLLSFLRS
DLSELRVRKPGGSSGDRGSNPLDGRDSPSAGGPVGQLEPIPIPAPASPGTRPTLKDLTAT
LRRAKSFTCSEKPMARRLPRTSALKSSSSELLLTGPGAEEDPLPLIVQDQYVQEARQVFE
KIQRMGAQQDDGSDAPPGSPDWAGDVTRGQRSQEELSGPESSLTDEGIGADPEPPVAAFC
GLGTTGMWRPLSSSSAQTNHHGPGTEDSLGGWALVSPETPPTPGALRRRRKVPPSGSGGS
ELSNGEAGEAYRSLSDPIPQRHRAATSEEPTGFSVDSNLLGSLSPKTGLPATSAMDEGLT
SGHSDWSVGSEESKGYQEVIQSIVQGPGTLGRVVDDRIAGKAPKKKSLSDPSRRGELAGP
GFEGPGGEPIREVEPMLPPSSSEPILVEQRAEPEEPGATRSRAQSERALPEALPPPATAH
RNFHLDPKLADILSPRLIRRGSKKRPARSSHQELRRDEGSQDQTGSLSRARPSSRHVRHA
SVPATFMPIVVPEPPTSVGPPVAVPEPIGFPTRAHPTLQAPSLEDVTKQYMLNLHSGEVP
APVPVDMPCLPLAAPPSAEAKPPEAARPADEPTPASKCCSKPQVDMRKHVAMTLLDTEQS
YVESLRTLMQGYMQPLKQPENSVLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCMQTWHA
QQKVGALLVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQ
ALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLEAQRNIKQVAERINKGVRSAEE
AERHARVLQEIEAHIEGMEDLQAPLRRFLRQEMVIEVKAIGGKKDRSLFLFTDLIVCTTL
KRKSGSLRRSSMSLYTAASVIDTASKYKMLWKLPLEDADIIKGASQATNRENIQKAISRL
DEDLTTLGQMSKLSESLGFPHQSLDDALRDLSAAMHRDLSEKQALCYALSFPPTKLELCA
TRPEGTDSYIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFS
CAAPTLNSCPEPSPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAVCSARILCIGAVPGLQ
PRCHREPPPSLRSPPETAPEPAGPELDVEAAADEEAATLAEPGPQPCLHISIAGSGLEMT
PGLGEGDPRPELVPFDSDSDDESSPSPSGTLQSQASRSTISSSFGNEETPSSKEATAETT
SSEEEQEPGFLPLSGSFGPGGPCGTSPMDGRALRRSSHGSFTRGSLEDLLSVDPEAYQSS
VWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGELVVYQREA
GHFWDPQNFKSVTLGTQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHMFYVGQDSS
RCVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAA
CLRITALLVCEELLWVGTSAGVVLTMPTSPGTVSCPRAPLSPTGLGQGHTGHVRFLAAVQ
LPDGFNLLCPTPPPPPDTGPEKLPSLEHRDSPWHRGPAPARPKMLVISGGDGYEDFRLSS
GGGSSSETVGRDDSTNHLLLWRV
GenBank ID Protein 21361458
UniProtKB/Swiss-Prot ID Q96PE2
UniProtKB/Swiss-Prot Entry Name ARHGH_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014786.3
GeneCard ID ARHGEF17
GenAtlas ID ARHGEF17
HGNC ID HGNC:21726
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  4. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  5. Carson-Walter EB, Watkins DN, Nanda A, Vogelstein B, Kinzler KW, St Croix B: Cell surface tumor endothelial markers are conserved in mice and humans. Cancer Res. 2001 Sep 15;61(18):6649-55. [PubMed:11559528 ]
  6. Rumenapp U, Freichel-Blomquist A, Wittinghofer B, Jakobs KH, Wieland T: A mammalian Rho-specific guanine-nucleotide exchange factor (p164-RhoGEF) without a pleckstrin homology domain. Biochem J. 2002 Sep 15;366(Pt 3):721-8. [PubMed:12071859 ]