You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11507
Secondary Accession Numbers
  • 17861
Name Rho guanine nucleotide exchange factor 12
Synonyms
  1. Leukemia-associated RhoGEF
Gene Name ARHGEF12
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and GNA13
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
intracellular
Function
small gtpase regulator activity
binding
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
protein binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
intracellular signaling pathway
signaling
signaling pathway
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cytoplasm (Probable)
  2. Membrane (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 11q23.3
SNPs ARHGEF12
Gene Sequence
>4635 bp
ATGAGTGGCACACAGTCTACTATCACCGACAGGTTTCCCCTCAAAAAACCTATAAGGCAT
GGAAGTATTTTGAACCGAGAGTCACCAACAGATAAGAAGCAGAAAGTTGAGCGCATTGCA
TCACATGATTTTGACCCCACAGATAGCTCCTCCAAGAAGACAAAGTCTAGTTCAGAGGAG
AGTAGATCCGAGATATATGGTCTTGTTCAGCGTTGCGTAATCATCCAGAAAGATGACAAT
GGATTTGGGCTGACGGTCAGTGGAGACAATCCAGTCTTCGTACAGTCTGTCAAAGAAGAT
GGAGCAGCCATGCGGGCTGGAGTACAGACAGGTGATCGAATCATCAAGGTGAATGGAACT
CTGGTGACTCATTCAAATCATCTGGAGGTGGTGAAGCTAATCAAATCTGGTTCCTATGTA
GCTCTCACTGTTCAGGGACGCCCACCTGGGTCGCCCCAGATTCCACTTGCCGACTCTGAA
GTAGAGCCGTCAGTCATTGGACATATGTCTCCCATCATGACATCTCCTCATTCACCTGGA
GCATCTGGGAATATGGAGAGAATCACTAGTCCTGTGCTCATGGGGGAGGAAAACAATGTG
GTTCATAACCAGAAAGTAGAAATTCTGAGAAAAATGTTACAGAAAGAACAGGAACGGCTA
CAGTTATTGCAGGAAGATTACAACCGAACACCTGCCCAAAGATTGCTAAAAGAGATCCAA
GAGGCCAAGAAACACATTCCTCAGCTGCAAGAGCAGTTATCCAAAGCCACAGGCTCTGCT
CAGGATGGAGCTGTAGTTACACCCTCCAGACCTTTAGGGGACACCCTAACAGTCAGTGAG
GCAGAAACAGATCCTGGAGATGTACTGGGCAGGACTGACTGTAGCAGTGGAGATGCTTCT
CGGCCCAGTAGTGACAATGCAGATAGTCCCAAGAGTGGCCCAAAAGAGAGAATTTATCTA
GAGGAAAACCCAGAGAAAAGTGAAACAATTCAGGACACTGACACTCAATCACTTGTCGGA
AGTCCCTCAACCCGTATAGCACCTCATATTATTGGAGCAGAAGATGATGATTTTGGTACT
GAACATGAACAGATCAATGGACAGTGCAGCTGTTTCCAGAGCATTGAATTACTAAAATCT
CGCCCGGCTCATTTGGCTGTTTTCTTACACCATGTAGTTTCACAATTTGACCCTGCGACT
TTGCTCTGTTATCTCTATTCAGACCTGTATAAACATACCAATTCCAAAGAAACTCGTCGC
ATCTTCCTTGAGTTTCATCAGTTCTTTCTAGATCGATCAGCACACCTGAAAGTTTCTGTT
CCTGATGAAATGTCTGCAGATCTAGAAAAGAGAAGACCTGAGCTCATTCCTGAGGATCTG
CATCGCCACTATATCCAAACTATGCAAGAAAGAGTCCATCCAGAAGTTCAAAGGCACTTA
GAAGATTTTCGGCAGAAACGTAGTATGGGACTGACCTTGGCTGAAAGCGAGCTGACTAAA
CTTGATGCAGAGCGAGACAAGGACCGATTGACTTTGGAGAAGGAGCGGACATGTGCAGAA
CAGATTGTTGCCAAAATTGAAGAAGTATTGATGACTGCTCAGGCTGTAGAGGAAGATAAG
AGCTCCACCATGCAGTATGTTATTCTCATGTATATGAAGCATTTGGGAGTAAAAGTGAAA
GAGCCTCGAAATTTGGAGCACAAACGGGGTCGGATTGGATTTCTTCCCAAAATCAAGCAA
AGTATGAAGAAAGATAAAGAAGGGGAAGAAAAAGGGAAGCGAAGAGGATTCCCCAGCATC
CTGGGACCCCCACGGAGACCAAGCCGTCATGACAACAGTGCAATTGGCAGAGCCATGGAA
CTACAGAAGGCGCGCCACCCTAAGCACTTATCCACACCCTCATCTGTGAGTCCTGAACCT
CAGGACTCTGCCAAGTTGCGCCAGAGTGGGTTAGCAAATGAAGGAACAGACGCTGGATAC
CTGCCTGCCAATTCCATGTCTTCTGTAGCTTCAGGGGCCTCTTTTTCCCAGGAAGGAGGG
AAAGAGAATGATACAGGATCAAAGCAAGTTGGAGAAACATCAGCACCTGGAGACACCTTA
GATGGCACACCTCGTACTCTCAATACTGTCTTTGATTTCCCACCACCTCCATTAGACCAA
GTGCAGGAGGAGGAATGTGAAGTAGAAAGGGTGACTGAACATGGGACACCAAAGCCCTTT
CGAAAGTTTGACAGTGTAGCTTTTGGAGAAAGTCAAAGTGAGGATGAACAATTTGAAAAT
GACTTAGAGACAGATCCACCCAACTGGCAGCAGCTTGTTAGTCGAGAAGTGTTACTGGGA
CTAAAACCTTGTGAAATCAAAAGACAGGAAGTGATTAATGAATTGTTCTACACTGAAAGA
GCTCATGTTCGAACACTGAAGGTTCTTGATCAAGTGTTCTATCAGCGAGTATCCAGAGAA
GGAATTCTGTCACCCTCAGAGCTACGGAAAATTTTTTCAAACTTGGAAGATATTCTTCAA
CTTCATATTGGATTGAATGAACAAATGAAGGCTGTTCGAAAGAGAAATGAGACCTCTGTT
ATCGATCAGATTGGGGAAGATTTGCTGACATGGTTCAGCGGACCAGGAGAGGAGAAATTG
AAACATGCTGCTGCTACCTTTTGCAGTAACCAACCTTTCGCCCTGGAAATGATCAAATCT
CGTCAGAAAAAGGATTCTCGATTTCAGACTTTTGTGCAAGATGCTGAAAGTAATCCACTG
TGTCGTCGTCTTCAACTGAAGGATATTATTCCCACTCAAATGCAAAGGCTTACTAAGTAC
CCACTTCTGTTGGATAATATTGCCAAATACACAGAATGGCCAACAGAAAGGGAGAAGGTG
AAGAAAGCTGCAGATCACTGTCGTCAGATCTTAAATTATGTAAATCAGGCTGTCAAGGAG
GCAGAAAACAAGCAGCGCCTAGAAGATTATCAGCGTCGCCTTGATACCTCCAGCCTGAAG
TTGTCAGAGTACCCAAATGTTGAAGAGCTCAGGAATTTGGATTTAACAAAAAGGAAGATG
ATTCATGAAGGGCCATTGGTTTGGAAGGTGAATAGAGATAAAACTATTGATTTATACACG
TTGCTGCTGGAAGACATTCTTGTATTGTTACAAAAGCAGGATGATAGACTGGTTTTAAGG
TGTCATAGTAAGATTCTGGCATCTACAGCTGATAGCAAACACACGTTTAGCCCTGTCATT
AAGTTGAGTACAGTGTTGGTTCGACAAGTGGCAACAGATAACAAAGCTTTATTCGTCATT
TCCATGTCAGACAATGGCGCTCAGATTTATGAACTGGTGGCACAGACAGTTTCTGAAAAG
ACTGTCTGGCAGGACCTAATCTGTCGGATGGCTGCATCAGTGAAGGAGCAATCCACAAAG
CCAATTCCATTACCACAGTCAACACCTGGCGAAGGAGATAATGATGAAGAAGATCCTTCA
AAATTAAAAGAGGAGCAGCATGGCATTTCAGTCACTGGTTTGCAGAGTCCAGACAGAGAT
TTGGGATTAGAATCTACCTTAATATCGTCAAAACCTCAGTCTCATTCACTGAGTACCTCT
GGGAAATCAGAGGTACGTGATCTGTTTGTGGCTGAGAGACAGTTTGCAAAGGAACAACAT
ACAGATGGGACACTAAAGGAAGTTGGAGAAGATTATCAAATCGCAATCCCAGATTCACAC
CTGCCTGTCTCAGAAGAACGGTGGGCATTGGATGCACTAAGAAATTTGGGTTTGTTGAAG
CAGTTGCTGGTGCAACAGCTAGGTTTGACTGAGAAGAGCGTTCAGGAAGACTGGCAACAT
TTCCCAAGATACAGAACAGCCTCTCAGGGGCCGCAGACAGACAGTGTCATCCAGAACTCT
GAAAATATTAAGGCCTATCATTCTGGTGAAGGACATATGCCCTTTAGAACTGGAACTGGT
GACATTGCAACTTGTTACAGTCCACGGACTTCAACTGAATCTTTTGCTCCACGGGATTCA
GTGGGACTGGCACCCCAGGATAGCCAGGCAAGTAACATTTTAGTAATGGACCACATGATT
ATGACCCCAGAGATGCCTACCATGGAGCCAGAAGGGGGTCTTGATGACAGTGGAGAGCAC
TTTTTTGATGCCCGTGAAGCACATAGTGATGAGAATCCATCAGAAGGTGATGGAGCAGTT
AACAAGGAAGAGAAGGATGTTAATTTACGCATCTCAGGAAACTATTTGATCCTTGATGGC
TATGACCCAGTGCAGGAGAGTTCCACAGATGAGGAGGTTGCTTCCTCACTTACCCTGCAG
CCCATGACAGGCATCCCTGCTGTGGAATCCACCCACCAGCAGCAACATTCTCCTCAGAAT
ACTCACTCCGATGGGGCAATTTCACCATTCACCCCCGAATTTCTGGTCCAGCAGCGCTGG
GGAGCTATGGAGTATTCCTGTTTTGAGATCCAGAGTCCCTCCTCTTGTGCAGATTCACAG
AGCCAGATCATGGAGTACATTCATAAGATAGAGGCTGACCTTGAACACTTAAAGAAGGTG
GAGGAAAGTTACACCATTCTTTGCCAAAGGCTGGCTGGATCAGCCCTCACAGACAAGCAC
TCAGATAAAAGTTAG
Protein Properties
Number of Residues 1544
Molecular Weight 173231.0
Theoretical pI 5.51
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho guanine nucleotide exchange factor 12
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERIASHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVVTPSRPLGDTLTVSEAETDPGDVLGRTDCSSGDAS
RPSSDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRR
IFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDKEGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMELQKARHPKHLSTPSSVSPEPQDSAKLRQSGLANEGTDAGY
LPANSMSSVASGASFSQEGGKENDTGSKQVGETSAPGDTLDGTPRTLNTVFDFPPPPLDQ
VQEEECEVERVTEHGTPKPFRKFDSVAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTK
PIPLPQSTPGEGDNDEEDPSKLKEEQHGISVTGLQSPDRDLGLESTLISSKPQSHSLSTS
GKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQIAIPDSHLPVSEERWALDALRNLGLLK
QLLVQQLGLTEKSVQEDWQHFPRYRTASQGPQTDSVIQNSENIKAYHSGEGHMPFRTGTG
DIATCYSPRTSTESFAPRDSVGLAPQDSQASNILVMDHMIMTPEMPTMEPEGGLDDSGEH
FFDAREAHSDENPSEGDGAVNKEEKDVNLRISGNYLILDGYDPVQESSTDEEVASSLTLQ
PMTGIPAVESTHQQQHSPQNTHSDGAISPFTPEFLVQQRWGAMEYSCFEIQSPSSCADSQ
SQIMEYIHKIEADLEHLKKVEESYTILCQRLAGSALTDKHSDKS
GenBank ID Protein 7662088
UniProtKB/Swiss-Prot ID Q9NZN5
UniProtKB/Swiss-Prot Entry Name ARHGC_HUMAN
PDB IDs
GenBank Gene ID NM_015313.2
GeneCard ID ARHGEF12
GenAtlas ID ARHGEF12
HGNC ID HGNC:14193
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  7. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  8. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  9. Driessens MH, Olivo C, Nagata K, Inagaki M, Collard JG: B plexins activate Rho through PDZ-RhoGEF. FEBS Lett. 2002 Oct 9;529(2-3):168-72. [PubMed:12372594 ]
  10. Perrot V, Vazquez-Prado J, Gutkind JS: Plexin B regulates Rho through the guanine nucleotide exchange factors leukemia-associated Rho GEF (LARG) and PDZ-RhoGEF. J Biol Chem. 2002 Nov 8;277(45):43115-20. Epub 2002 Aug 14. [PubMed:12183458 ]
  11. Kourlas PJ, Strout MP, Becknell B, Veronese ML, Croce CM, Theil KS, Krahe R, Ruutu T, Knuutila S, Bloomfield CD, Caligiuri MA: Identification of a gene at 11q23 encoding a guanine nucleotide exchange factor: evidence for its fusion with MLL in acute myeloid leukemia. Proc Natl Acad Sci U S A. 2000 Feb 29;97(5):2145-50. [PubMed:10681437 ]
  12. Fukuhara S, Chikumi H, Gutkind JS: Leukemia-associated Rho guanine nucleotide exchange factor (LARG) links heterotrimeric G proteins of the G(12) family to Rho. FEBS Lett. 2000 Nov 24;485(2-3):183-8. [PubMed:11094164 ]
  13. Taya S, Inagaki N, Sengiku H, Makino H, Iwamatsu A, Urakawa I, Nagao K, Kataoka S, Kaibuchi K: Direct interaction of insulin-like growth factor-1 receptor with leukemia-associated RhoGEF. J Cell Biol. 2001 Nov 26;155(5):809-20. Epub 2001 Nov 26. [PubMed:11724822 ]