Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11510
Secondary Accession Numbers
  • 17864
Name Guanine nucleotide-binding protein G(olf) subunit alpha
Synonyms
  1. Adenylate cyclase-stimulating G alpha protein, olfactory type
Gene Name GNAL
Protein Type Unknown
Biological Properties
General Function Involved in signal transducer activity
Specific Function Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. May be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
molecular transducer activity
signal transducer activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 18p11.22-p11.21
SNPs GNAL
Gene Sequence
>1146 bp
ATGGGGTGTTTGGGCGGCAACAGCAAGACGACGGAAGACCAGGGCGTCGATGAAAAAGAA
CGACGCGAGGCCAACAAAAAGATCGAGAAGCAGTTGCAGAAAGAGCGCCTGGCTTACAAG
GCTACCCACCGCCTGCTGCTCCTGGGGGCTGGTGAGTCTGGGAAAAGCACTATCGTCAAA
CAGATGAGGATCCTGCACGTCAATGGGTTTAATCCCGAGGAAAAGAAACAGAAAATTCTG
GACATCCGGAAAAATGTTAAAGATGCTATCGTGACAATTGTTTCAGCAATGAGTACTATA
ATACCTCCAGTTCCGCTGGCCAACCCTGAAAACCAATTTCGATCAGACTACATCAAGAGC
ATAGCCCCTATCACTGACTTTGAATATTCCCAGGAATTCTTTGACCATGTGAAAAAACTT
TGGGACGATGAAGGCGTGAAGGCATGCTTTGAGAGATCCAACGAATACCAGCTGATTGAC
TGTGCACAATACTTCCTGGAAAGAATCGACAGCGTCAGCTTGGTTGACTACACACCCACA
GACCAGGACCTCCTCAGATGCAGAGTTCTGACATCTGGGATTTTTGAGACACGATTCCAA
GTGGACAAAGTAAACTTCCACATGTTTGATGTTGGTGGCCAGAGGGATGAGAGGAGAAAA
TGGATCCAGTGCTTTAACGATGTCACAGCTATCATTTACGTCGCAGCCTGCAGTAGCTAC
AACATGGTGATTCGAGAAGATAACAACACCAACAGGCTGAGAGAGTCCCTGGATCTTTTT
GAAAGCATCTGGAACAACAGGTGGTTACGGACCATTTCTATCATCTTGTTCTTGAACAAA
CAAGATATGCTGGCAGAAAAAGTCTTGGCAGGGAAATCAAAAATTGAAGACTATTTCCCA
GAATATGCAAATTATACTGTTCCTGAAGACGCAACACCAGATGCAGGAGAAGATCCCAAA
GTTACAAGAGCCAAGTTCTTTATCCGGGACCTGTTTTTGAGGATCAGCACGGCCACCGGT
GACGGCAAACATTACTGCTACCCGCACTTCACCTGCGCCGTGGACACAGAGAACATCCGC
AGGGTGTTCAACGACTGCCGCGACATCATCCAGCGGATGCACCTCAAGCAGTATGAGCTC
TTGTGA
Protein Properties
Number of Residues 381
Molecular Weight 44308.1
Theoretical pI 6.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Guanine nucleotide-binding protein G(olf) subunit alpha
MGCLGGNSKTTEDQGVDEKERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVK
QMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKS
IAPITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPT
DQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIYVAACSSY
NMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFP
EYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIR
RVFNDCRDIIQRMHLKQYELL
GenBank ID Protein 20147679
UniProtKB/Swiss-Prot ID P38405
UniProtKB/Swiss-Prot Entry Name GNAL_HUMAN
PDB IDs Not Available
GenBank Gene ID AF493893
GeneCard ID GNAL
GenAtlas ID GNAL
HGNC ID HGNC:4388
References
General References
  1. Zigman JM, Westermark GT, LaMendola J, Boel E, Steiner DF: Human G(olf) alpha: complementary deoxyribonucleic acid structure and expression in pancreatic islets and other tissues outside the olfactory neuroepithelium and central nervous system. Endocrinology. 1993 Dec;133(6):2508-14. [PubMed:8243272 ]