You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11511
Secondary Accession Numbers
  • 17865
Name Guanine nucleotide-binding protein subunit alpha-15
Synonyms
  1. G alpha-15
  2. G alpha-16
  3. G-protein subunit alpha-15
  4. G-protein subunit alpha-16
  5. Guanine nucleotide-binding protein subunit alpha-16
Gene Name GNA15
Protein Type Unknown
Biological Properties
General Function Involved in signal transducer activity
Specific Function Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
molecular transducer activity
signal transducer activity
Process
metabolic process
macromolecule metabolic process
protein amino acid adp-ribosylation
biological regulation
regulation of biological process
post-translational protein modification
regulation of cellular process
signal transduction
macromolecule modification
protein modification process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.3
SNPs GNA15
Gene Sequence
>1125 bp
ATGGCCCGCTCGCTGACCTGGCGCTGCTGCCCCTGGTGCCTGACGGAGGATGAGAAGGCC
GCCGCCCGGGTGGACCAGGAGATCAACAGGATCCTCTTGGAGCAGAAGAAGCAGGACCGC
GGGGAGCTGAAGCTGCTGCTTTTGGGCCCAGGCGAGAGCGGGAAGAGCACCTTCATCAAG
CAGATGCGGATCATCCACGGCGCCGGCTACTCGGAGGAGGAGCGCAAGGGCTTCCGGCCC
CTGGTCTACCAGAACATCTTCGTGTCCATGCGGGCCATGATCGAGGCCATGGAGCGGCTG
CAGATTCCATTCAGCAGGCCCGAGAGCAAGCACCACGCTAGCCTGGTCATGAGCCAGGAC
CCCTATAAAGTGACCACGTTTGAGAAGCGCTACGCTGCGGCCATGCAGTGGCTGTGGAGG
GATGCCGGCATCCGGGCCTACTATGAGCGTCGGCGGGAATTCCACCTGCTCGATTCAGCC
GTGTACTACCTGTCCCACCTGGAGCGCATCACCGAGGAGGGCTACGTCCCCACAGCTCAG
GACGTGCTCCGCAGCCGCATGCCCACCACTGGCATCAACGAGTACTGCTTCTCCGTGCAG
AAAACCAACCTGCGGATCGTGGACGTCGGGGGCCAGAAGTCAGAGCGTAAGAAATGGATC
CATTGTTTCGAGAACGTGATCGCCCTCATCTACCTGGCCTCACTGAGTGAATACGACCAG
TGCCTGGAGGAGAACAACCAGGAGAACCGCATGAAGGAGAGCCTCGCATTGTTTGGGACT
ATCCTGGAACTACCCTGGTTCAAAAGCACATCCGTCATCCTCTTTCTCAACAAAACCGAC
ATCCTGGAGGAGAAAATCCCCACCTCCCACCTGGCTACCTATTTCCCCAGTTTCCAGGGC
CCTAAGCAGGATGCTGAGGCAGCCAAGAGGTTCATCCTGGACATGTACACGAGGATGTAC
ACCGGGTGCGTGGACGGCCCCGAGGGCAGCAAGAAGGGCGCACGATCCCGACGCCTCTTC
AGCCACTACACATGTGCCACAGACACACAGAACATCCGCAAGGTCTTCAAGGACGTGCGG
GACTCGGTGCTCGCCCGCTACCTGGACGAGATCAACCTGCTGTGA
Protein Properties
Number of Residues 374
Molecular Weight 43507.6
Theoretical pI 8.59
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Guanine nucleotide-binding protein subunit alpha-15
MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIK
QMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQD
PYKVTTFEKRYAAAMQWLWRDAGIRACYERRREFHLLDSAVYYLSHLERITEEGYVPTAQ
DVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQ
CLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG
PKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVR
DSVLARYLDEINLL
GenBank ID Protein 156104883
UniProtKB/Swiss-Prot ID P30679
UniProtKB/Swiss-Prot Entry Name GNA15_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002068.2
GeneCard ID GNA15
GenAtlas ID GNA15
HGNC ID HGNC:4383
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Amatruda TT 3rd, Steele DA, Slepak VZ, Simon MI: G alpha 16, a G protein alpha subunit specifically expressed in hematopoietic cells. Proc Natl Acad Sci U S A. 1991 Jul 1;88(13):5587-91. [PubMed:1905813 ]