You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11531
Secondary Accession Numbers
  • 20975
Name Putative lipoyltransferase 2, mitochondrial
Synonyms
  1. Lipoate-protein ligase B
  2. Lipoyl/octanoyl transferase
  3. Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase
Gene Name LIPT2
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
octanoyltransferase activity
Process
metabolic process
lipoic acid metabolic process
lipoic acid biosynthetic process
lipoate biosynthetic process
macromolecule metabolic process
cellular metabolic process
macromolecule modification
protein modification process
cofactor metabolic process
coenzyme metabolic process
Cellular Location
  1. Mitochondrion (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.4
SNPs LIPT2
Gene Sequence
>696 bp
ATGCGGCAACCCGCCGTTCGGTTGGTGCGCCTGGGTCGGGTGCCGTACGCCGAGCTACTG
GGGCTGCAGGACCGCTGGCTGCGGCGGCTGCAGGCCGAGCCAGGCATTGAGGCCCCGTCG
GGGACTGAGGCGGGCGCGCTCCTGCTCTGCGAGCCCGCGGGGCCCGTGTATACGGCCGGG
CTGCGCGGCGGCCTGACGCCCGAGGAAACTGCGCGGCTACGGGCCTTGGGCGCCGAGGTG
CGCGTCACAGGCCGCGGTGGCCTGGCCACCTTCCACGGCCCGGGCCAGCTGCTTTGCCAC
CCGGTACTCGACCTGCGGCGTCTCGGCCTGCGCTTGCGCATGCACGTAGCGTCGCTGGAG
GCGTGCGCCGTGCGCCTGTGCGAGCTCCAGGGCCTGCAGGACGCCCGCGCGCGGCCCCCG
CCCTACACTGGCGTCTGGCTAGACGATCGCAAGATCTGCGCGATCGGAGTCCGCTGTGGA
AGGCACATCACATCCCACGGCCTGGCTCTCAACTGCTCTACCGACCTCACGTGGTTTGAG
CACATCGTGCCCTGTGGACTGGTTGGGACAGGCGTCACTTCCTTGAGTAAGGAGCTCCAG
AGGCACGTCACCGTGGAAGAAGTAATGCCACCTTTCCTTGTGGCCTTTAAGGAGATCTAC
AAGTGCACACTGATCTCAGAGGACAGCCCCAACTGA
Protein Properties
Number of Residues 231
Molecular Weight 25195.1
Theoretical pI 8.34
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Putative lipoyltransferase 2, mitochondrial
MRQPAVRLVRLGRVPYAELLGLQDRWLRRLQAEPGIEAPSGTEAGALLLCEPAGPVYTAG
LRGGLTPEETARLRALGAEVRVTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRMHVASLE
ACAVRLCELQGLQDARARPPPYTGVWLDDRKICAIGVRCGRHITSHGLALNCSTDLTWFE
HIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCTLISEDSPN
GenBank ID Protein 221554520
UniProtKB/Swiss-Prot ID A6NK58
UniProtKB/Swiss-Prot Entry Name LIPT2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001144869.1
GeneCard ID LIPT2
GenAtlas ID LIPT2
HGNC ID HGNC:37216
References
General References
  1. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]