Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11553
Secondary Accession Numbers
  • 20997
Name Ubiquitin carboxyl-terminal hydrolase 11
Synonyms
  1. Deubiquitinating enzyme 11
  2. Ubiquitin thiolesterase 11
  3. Ubiquitin-specific-processing protease 11
Gene Name USP11
Protein Type Enzyme
Biological Properties
General Function Involved in ubiquitin thiolesterase activity
Specific Function Protease that can remove conjugated ubiquitin from target proteins and polyubiquitin chains. Inhibits the degradation of target proteins by the proteasome. Plays a role in the regulation of pathways leading to NF-kappa-B activation. Plays a role in the regulation of DNA repair after double-stranded DNA breaks
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
ubiquitin thiolesterase activity
thiolester hydrolase activity
Process
metabolic process
catabolic process
macromolecule catabolic process
cellular macromolecule catabolic process
modification-dependent macromolecule catabolic process
modification-dependent protein catabolic process
ubiquitin-dependent protein catabolic process
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs USP11
Gene Sequence
>2892 bp
ATGGCAGTAGCCCCGCGACTGTTTGGGGGGCTCTGCTTCCGTTTCCGGGACCAGAATCCG
GAAGTGGCTGTTGAGGGGCGTCTTCCAATCTCGCACAGCTGCGTTGGCTGTAGAAGAGAA
CGGACGGCGATGGCGACGGTCGCAGCAAATCCAGCTGCTGCTGCGGCGGCTGTGGCGGCG
GCAGCGGCGGTGACTGAGGATAGAGAGCCACAGCACGAGGAGCTGCCAGGCCTGGACAGC
CAGTGGCGCCAGATAGAAAACGGCGAGAGTGGGCGAGAACGTCCACTGCGGGCCGGCGAA
AGCTGGTTCCTTGTGGAGAAGCACTGGTATAAGCAGTGGGAGGCATACGTGCAGGGAGGG
GACCAGGACTCCAGCACCTTCCCTGGCTGCATCAACAATGCCACACTCTTTCAAGATGAG
ATAAACTGGCGCCTCAAGGAGGGACTGGTGGAAGGCGAGGATTATGTGCTGCTCCCAGCA
GCTGCTTGGCATTACCTGGTCAGCTGGTATGGTCTAGAGCATGGCCAGCCACCCATTGAA
CGCAAGGTCATAGAGCTGCCCAACATCCAGAAGGTCGAAGTGTACCCAGTAGAACTGCTG
CTTGTCCGGCACAATGATTTGGGCAAATCTCACACTGTTCAGTTCAGCCATACCGATTCT
ATTGGCCTAGTATTGCGCACAGCTCGGGAGCGGTTTCTGGTGGAGCCCCAGGAAGACACT
CGGCTTTGGGCCAAGAACTCAGAAGGCTCTTTGGATAGGTTGTATGACACACACATCACG
GTTCTCGATGCGGCCCTTGAGACTGGGCAGTTGATCATCATGGAGACCCGCAAGAAAGAT
GGCACTTGGCCCAGCGCACAGCTGCATGTCATGAACAACAACATGTCGGAAGAGGATGAG
GACTTCAAGGGTCAGCCAGGCATCTGTGGCCTCACCAATCTGGGCAACACGTGCTTCATG
AACTCGGCCCTGCAGTGCCTCAGCAATGTGCCACAGCTCACCGAGTACTTCCTCAACAAC
TGCTACCTGGAGGAGCTCAACTTCCGCAACCCACTGGGCATGAAGGGTGAGATCGCAGAG
GCCTATGCAGACCTGGTGAAGCAGGCGTGGTCTGGCCACCACCGCTCCATTGTGCCACAT
GTGTTCAAGAACAAGGTTGGCCATTTTGCATCCCAATTTCTGGGCTACCAGCAGCATGAC
TCTCAGGAGCTGCTGTCATTCCTCCTGGACGGGCTGCATGAGGACCTTAATCGGGTGAAG
AAGAAGGAGTATGTGGAGCTGTGCGATGCTGCTGGGCGACCGGATCAGGAGGTGGCACAG
GAGGCATGGCAAAACCACAAACGGCGGAACGATTCTGTGATCGTGGACACTTTCCACGGC
CTCTTCAAGTCCACGCTGGTGTGCCCCGATTGTGGCAATGTATCTGTGACCTTCGACCCC
TTCTGCTACCTCAGTGTTCCACTGCCTATCAGCCACAAGAGGGTCTTGGAGGTCTTCTTT
ATCCCCATGGATCCGCGCCGCAAGCCAGAGCAGCACCGGCTCGTGGTCCCCAAGAAAGGC
AAGATCTCGGATCTATGTGTGGCTCTGTCCAAACACACGGGCATCTCGCCAGAGAGGATG
ATGGTGGCTGATGTCTTCAGTCACCGCTTCTATAAGCTCTATCAGCTAGAGGAGCCTCTG
AGCAGCATCTTGGACCGTGATGATATCTTCGTCTATGAGGTGTCAGGTCGCATTGAGGCC
ATTGAGGGCTCAAGAGAGGACATCGTGGTTCCTGTCTACCTGCGGGAGCGCACCCCTGCC
CGTGACTACAACAACTCCTACTACGGCCTGATGCTTTTTGGACACCCCCTCCTGGTATCA
GTGCCCCGGGACCGCTTCACCTGGGAGGGCCTGTATAACGTCCTGATGTACCGGCTCTCA
CGCTACGTGACCAAACCCAACTCAGATGATGAGGACGATGGGGATGAGAAAGAAGATGAC
GAGGAGGATAAAGATGACGTCCCTGGGCCCTCAACTGGGGGCAGCCTCCGAGACCCTGAG
CCAGAGCAGGCTGGGCCCAGCTCTGGAGTCACGAACAGGTGCCCGTTCCTCCTGGACAAT
TGCCTTGGCACATCTCAGTGGCCCCCAAGGCGACGACGCAAGCAGCTGTTCACCCTGCAG
ACGGTGAACTCCAATGGGACCAGCGACCGCACAACCTCCCCTGAAGAAGTCCATGCCCAG
CCGTACATTGCTATCGACTGGGAGCCAGAGATGAAGAAGCGTTACTATGACGAGGTAGAG
GCTGAGGGCTACGTGAAGCATGACTGCGTCGGGTACGTGATGAAGAAGGCTCCCGTGCGG
CTGCAGGAGTGCATTGAGCTCTTCACCACTGTGGAGACCCTGGAGAAGGAAAACCCCTGG
TACTGCCCTTCCTGCAAGCAGCACCAGCTGGCAACCAAGAAGCTGGACCTGTGGATGCTG
CCGGAGATTCTCATCATCCACCTGAAACGCTTTTCCTACACCAAGTTCTCCCGAGAGAAG
CTGGACACCCTCGTGGAGTTTCCTATCCGGGACCTGGACTTCTCTGAGTTTGTCATCCAG
CCACAGAATGAGTCGAATCCGGAGCTGTACAAATATGACCTCATCGCGGTTTCCAACCAT
TATGGGGGCATGCGTGATGGACACTACACAACATTTGCCTGCAACAAGGACAGCGGCCAG
TGGCACTACTTTGATGACAACAGCGTCTCCCCTGTCAATGAGAATCAGATCGAGTCCAAG
GCAGCCTATGTCCTCTTCTACCAACGCCAGGACGTGGCGCGACGCCTGCTGTCCCCGGCC
GGCTCATCTGGCGCCCCAGCCTCCCCTGCCTGCAGCTCCCCACCCAGCTCTGAGTTCATG
GATGTTAATTGA
Protein Properties
Number of Residues 963
Molecular Weight 109815.8
Theoretical pI 5.14
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ubiquitin carboxyl-terminal hydrolase 11
MAVAPRLFGGLCFRFRDQNPEVAVEGRLPISHSCVGCRRERTAMATVAANPAAAAAAVAA
AAAVTEDREPQHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGG
DQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIE
RKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDT
RLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE
DFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAE
AYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVK
KKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDP
FCYLSVPLPISHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPERM
MVADVFSHRFYKLYQLEEPLSSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERTPA
RDYNNSYYGLMLFGHPLLVSVPRDRFTWEGLYNVLMYRLSRYVTKPNSDDEDDGDEKEDD
EEDKDDVPGPSTGGSLRDPEPEQAGPSSGVTNRCPFLLDNCLGTSQWPPRRRRKQLFTLQ
TVNSNGTSDRTTSPEEVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVMKKAPVR
LQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREK
LDTLVEFPIRDLDFSEFVIQPQNESNPELYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQ
WHYFDDNSVSPVNENQIESKAAYVLFYQRQDVARRLLSPAGSSGAPASPACSSPPSSEFM
DVN
GenBank ID Protein 187954551
UniProtKB/Swiss-Prot ID P51784
UniProtKB/Swiss-Prot Entry Name UBP11_HUMAN
PDB IDs Not Available
GenBank Gene ID BC140849
GeneCard ID USP11
GenAtlas ID USP11
HGNC ID HGNC:12609
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  5. Ideguchi H, Ueda A, Tanaka M, Yang J, Tsuji T, Ohno S, Hagiwara E, Aoki A, Ishigatsubo Y: Structural and functional characterization of the USP11 deubiquitinating enzyme, which interacts with the RanGTP-associated protein RanBPM. Biochem J. 2002 Oct 1;367(Pt 1):87-95. [PubMed:12084015 ]
  6. Swanson DA, Freund CL, Ploder L, McInnes RR, Valle D: A ubiquitin C-terminal hydrolase gene on the proximal short arm of the X chromosome: implications for X-linked retinal disorders. Hum Mol Genet. 1996 Apr;5(4):533-8. [PubMed:8845848 ]
  7. Schoenfeld AR, Apgar S, Dolios G, Wang R, Aaronson SA: BRCA2 is ubiquitinated in vivo and interacts with USP11, a deubiquitinating enzyme that exhibits prosurvival function in the cellular response to DNA damage. Mol Cell Biol. 2004 Sep;24(17):7444-55. [PubMed:15314155 ]
  8. Yamaguchi T, Kimura J, Miki Y, Yoshida K: The deubiquitinating enzyme USP11 controls an IkappaB kinase alpha (IKKalpha)-p53 signaling pathway in response to tumor necrosis factor alpha (TNFalpha). J Biol Chem. 2007 Nov 23;282(47):33943-8. Epub 2007 Sep 26. [PubMed:17897950 ]
  9. Lin CH, Chang HS, Yu WC: USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. J Biol Chem. 2008 Jun 6;283(23):15681-8. doi: 10.1074/jbc.M708278200. Epub 2008 Apr 11. [PubMed:18408009 ]
  10. Sun W, Tan X, Shi Y, Xu G, Mao R, Gu X, Fan Y, Yu Y, Burlingame S, Zhang H, Rednam SP, Lu X, Zhang T, Fu S, Cao G, Qin J, Yang J: USP11 negatively regulates TNFalpha-induced NF-kappaB activation by targeting on IkappaBalpha. Cell Signal. 2010 Mar;22(3):386-94. doi: 10.1016/j.cellsig.2009.10.008. [PubMed:19874889 ]
  11. Wiltshire TD, Lovejoy CA, Wang T, Xia F, O'Connor MJ, Cortez D: Sensitivity to poly(ADP-ribose) polymerase (PARP) inhibition identifies ubiquitin-specific peptidase 11 (USP11) as a regulator of DNA double-strand break repair. J Biol Chem. 2010 May 7;285(19):14565-71. doi: 10.1074/jbc.M110.104745. Epub 2010 Mar 15. [PubMed:20233726 ]